KEGG   Drosophila grimshawi: Dgri_GH10149Help
Entry
Dgri_GH10149      CDS       T01061                                 

Definition
(RefSeq) GH10149 gene product from transcript GH10149-RA
  KO
K11253  histone H3
Organism
dgr  Drosophila grimshawi
Brite
Chromosome and associated proteins [BR:dgr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dgri_GH10149
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH10149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 6570998
NCBI-ProteinID: XP_001997209
FlyBase: FBgn0117630
UniProt: B4JZ48
LinkDB All DBs
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtactaagcagactgctcgtaaatcgacgggaggcaaggctcctcgcaaacag
ttggcaactaaggcagcacgtaaaagtgctccagcaaccggtggtgtgaagaaacctcat
cgctatcgtcccggtacagttgcactgcgtgaaattcgtcgctaccagaagagcacagag
ttgcttatccgcaagctgccgttccagcgtttagtacgcgaaattgctcaggacttcaag
accgatttacgtttccagagttcggctgtgatggctctgcaagaagctagcgaagcctac
ctggttggcctatttgaagacacgaacttgtgtgctatccatgctaagcgtgtcaccatc
atgcccaaagatatccaactggccagacgcattcgtggcgaacgtgcttaa

DBGET integrated database retrieval system