KEGG   Drosophila grimshawi: Dgri_GH10783
Entry
Dgri_GH10783      CDS       T01061                                 

Definition
(RefSeq) GH10783 gene product from transcript GH10783-RA
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00230  Purine metabolism
dgr01100  Metabolic pathways
dgr04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dgri_GH10783
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dgri_GH10783
Enzymes [BR:dgr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Dgri_GH10783
SSDB
Motif
Pfam: Guanylate_cyc AC_N Raftlin Spo12
Other DBs
NCBI-GeneID: 6562956
NCBI-ProteinID: XP_001988037
FlyBase: FBgn0118264
UniProt: B4JB99
LinkDB
AA seq 1173 aa
MPEEKASNLENGQTTAASTPSHSQKAKRQKTPTRRRPPNEGDVVAGGVGITGGGVVILPQ
HVLNELYHNYSIKQRRSGLKWFLFAAVLFNLWTICIPWEQALPTRVVNCSMLLAYMALTA
LLHIGRGSEQPSLRRFHQSLLTIVPRALWFLSMLHFAAYVMLQDSFSPRDVLGWAILLNF
LIYVTLPLPLIFLGLVIGFCTYFNCLSLPVGFSRPDRLISDQAAANAVLIATAALIGLLY
YFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAF
KKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILG
DCYYCISGAPDERPDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQ
RQWQFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGL
KTYFITKVVKPFASPCSKKINESKSEDANHSPDSNASSNDSNENAGDDNDATLDDEELLA
QSVVINGHNPTAAEDEEEQIKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQA
YAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVAISIAESF
GGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHIVSESEFN
ATAGLEEVVTAEHLLPESFVEQMRDAVPTERVLYPSYLSNFSVLILIAIAVIAQLTHLTK
ILLLLSIAALHCYFNVCIMQDLYVLEDDLANQPLISTRYCASGLLLVAALSLSFLARHMD
HEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYA
EVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGST
YMAASGINLQRNLRNDAPITERWSHLAVLVEFALELKHALQGINEQSFNHFVLKMGINHG
PITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAVQVTEETCKILEPFGYMFQQRGLVV
VKGKGQLMTYYLQGKSESSTAAVPKAAIELHGAEEGAETGTAPVSNLECSTELEADIKTP
LLKLKAKDAATEAAATESCLSNGTVGESQSLLE
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgccggaagagaaggcatccaatcttgagaatggccagacaacggcagcatccacaccc
agccacagccagaaggccaaacgccagaagaccccaacacgccgacggccacccaatgag
ggggacgtcgtcgccggtggtgtgggcatcaccggtggcggtgtggtcatcctgccccag
cacgtactcaacgaactctatcacaactattccatcaagcagcgacgcagcggcctcaag
tggttcctatttgcggccgtcctcttcaatctgtggacgatttgcataccatgggagcag
gccctgcccacccgggtggtgaactgcagcatgttgttggcctacatggcgctaacggct
ctgttgcacattggacgtggttcggagcagccctcattgagacgcttccaccaatcgttg
ctgacgattgtgccacgtgccctgtggtttctgtcgatgctccatttcgccgcctatgtg
atgctgcaggacagcttctcgccgcgggatgtactcggctgggccatattgttaaacttt
ctgatatatgtgacgctgccattgccactgatttttctgggcttagtcattggcttttgc
acgtacttcaattgcctgagtctgccggtgggcttctcacggccggatcggttaatctcc
gatcaggcggcggctaatgcggttttgatagcgaccgcggcgttaattggcctattgtat
tactttatgggcgaggccaagcagaagcgtgcctttttggaggccaagaagagtctggaa
gttaagatggtcatcgaggagcagtcggcggagcaggaacgtttgctattatctgtgctg
cccaagcacgtggccattaagatgcgcgaggatttgggctcatccagctcggaggcattc
aaaaagatctacatgagtcggcatgagaatgttagcatactgtatgcggacattgtcggt
ttcaccgccatctcctcgacgtatagcgcccaagatctggtgaaaatgctaaacgagctc
ttcgcacgcttcgataggctcgccgagaagtatcaacaactgcgcatcaaaattctcggt
gattgctattattgcattagtggagcgcccgacgagcgaccggatcatgccgtgctctgt
gtacacatgggactttcaatggtgaaggccatcaaatatgtgcaacagaaggcgaactca
cctgttgatatgcgtgtgggcatacacacgggagctgtcctggccggcattcttggccag
cgtcagtggcagtttgacgtttactccaaggacgttgagctggctaataaaatggagtcg
agcggcaaggccggacgcgtgcacatttccgacaagacattggccttcctcaatggcgag
ttcgaggtggagcccgcctttggtgagaagcgcgaggaactgcttcgcatagcgggccta
aagacctacttcattaccaaagtggttaagccgttcgcctcaccgtgcagcaagaaaatc
aacgaatccaagtcggaggatgccaatcacagtcccgactcgaatgcaagcagcaacgat
agcaacgagaatgctggcgatgacaatgatgccaccctggatgatgaggagctgctggcc
cagagcgtcgtcatcaacggacacaatccaacggccgccgaggatgaggaggagcaaatc
aagctggagaatttcaagcagcgcttgaaggatgagctcgtcacacgcgatggacatgaa
aatctgaccaaggacacaaacatatttctgcgcttcaagaacccgcagctggaacaggcc
tatgccgtctatcgtgaaccgtacagctctctgccattgctggccgcattgctggtgcag
tgcatcgatgtgttgtactcctatctggtgttgccacgttcgacgttgcatttcattaat
attgcggcaccgctggtgccaattgcaatgctggtggcaattagcattgcggaaagcttt
ggtggcatgctgcccaagttctttgtggacgtgagcaagcgattcaatgacattaccttc
gtgcgcgaactggcggccataattatagcactcaccattgggctgagcaacgtcatcgac
atgttcttctttgtcaccttcgttcgcaccgagcacattgtgagcgagagtgaattcaat
gccacggccggactggaggaggtggtcaccgccgagcacctacttcccgaatcctttgtg
gagcaaatgcgggacgcggtgccaaccgaacgtgtcctatatccgtcctatctgagcaac
ttcagtgtccttatactcatcgcaatcgctgtgattgctcagctcacccatttgaccaag
atcttgctgctcttgtccattgctgctctacattgctattttaatgtgtgcatcatgcag
gatttatacgtactggaagatgatctagcaaatcagccactcatatcaacacgttactgt
gcctcaggtctgctactggttgccgcattgtcgctcagctttctggcgcgtcatatggat
catgaggatcgcgtaatcttcaaatggaaaaccgaggtggccgaacagaaggaaaccgcc
aacgatatgcgacaacgaaatgaggcattggtctacaatgtgttgccggtgcacgtcgcc
gagcattttatgaagaacacaaagcgttcccatgacgatctctactcccagagctatgcc
gaggtgggcgttctatttgccagcatgcccaacttttcagacttttactcggaggaaaca
gttaacaatcagggcttggagtgtctgcgttttctcaatgaggtcatctctgacttcgat
gcgctgctggaattgccacaattccaggacataattaaaatcaagaccattggatccacg
tatatggcggccagtgggattaatttgcagcgcaatctgcgcaacgatgcaccaattacc
gaacgctggtcccatctggccgtgctcgtggagtttgccttggagctgaagcatgcgctg
cagggcatcaatgagcagtccttcaatcatttcgtattgaaaatgggcatcaatcatgga
ccgataacggctggtgtgattggcgcccggaagccacactacgatatctggggcaatacg
gtgaatgtggcgtcgcgcatggagagcactggcaaagcgggcgctgtccaggtcaccgag
gagacctgcaagatactcgaaccatttggctatatgttccagcaacgcggcctggtcgtc
gtcaagggcaagggccagctaatgacctactatttgcagggtaaatcggagagcagcaca
gcagcagtgcccaaggcggccattgaattgcatggcgctgaggagggtgcagaaacagga
actgctcccgttagtaatcttgagtgcagcacggagctggaggcggatattaagacaccg
ctgctgaagcttaaagcgaaggatgcagcaacggaagcagctgccaccgaatcctgtctg
agtaatggcacagtgggcgaatctcaatcgttgttggagtaa

DBGET integrated database retrieval system