KEGG   Drosophila grimshawi: Dgri_GH10960Help
Entry
Dgri_GH10960      CDS       T01061                                 

Definition
(RefSeq) GH10960 gene product from transcript GH10960-RA
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dgri_GH10960
Peptidases [BR:dgr01002]
 Metallo Peptidases
  Family M2
   Dgri_GH10960
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH10960
CD molecules [BR:dgr04090]
 Proteins
  Dgri_GH10960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 6561617
NCBI-ProteinID: XP_001988063
FlyBase: FBgn0118441
UniProt: B4JBC5
LinkDB All DBs
AA seq 632 aa AA seqDB search
MKGLLLLPLLLTLAFVLSLPYGVADSNTCSASVLQARRFFDQENSKLRERYHAEYSAAYA
YNTNVTEDNRRAMIAVYAESAKQNKLLAEAVKAGEYDESEDAQIRRQARMLQDLGADALN
ASDYLELKNAISQMQSNYATTTVCSYTNRTDCSLTLEPHIQERLSNSRDPAELAWYWREW
YDKAGTPMRENFATYVRLTRKAAHLNNYRSYADYWVHFYEDTDFERQLDATYKALLPFYR
QIHGYVRYRLRQHYGPDVVPAEGNIPMHLLGNMWAQSWNDVIDLFTPYPEKPFVDVKSEM
ERQEYSVQKLFQLGDQFFQSLGMRALPPTFWNASVLERPLDREVICHASAWDFYQDSDVR
IKMCTEVDTHYLYVVHHELGHIQYYLQYEQQPAVFRGAPNPGFHEAVGDVIALSVMSAKH
LKSIGLTSNGRLDEKSRINELFKQALSKIVFLPFGYTMDKYRYAVFRNELDENQWNCGFW
QMRSEFGGVEPPMMRTDTDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRLAGQYVP
GDSRQTLDNCDIFGSKKAGEAFKTFLSAGNSKHWKEVLEELTGETEMDPAALLEYFDPLY
QWLKLENSRLGVPLGWNETNKIPSSCCGAFST
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggctgctgttgctgcctttgctgcttacgcttgcctttgtgctctcgctaccg
tacggagtcgccgatagtaacacttgctccgcatctgtgctgcaagctcgtcgcttcttt
gatcaggagaactctaagctgcgagaacgttatcatgccgagtactccgctgcctatgct
tacaacaccaatgtgacagaggataatcgtcgtgccatgattgccgtctatgcggagagt
gccaagcagaacaaactgttggcggaggcagtcaaggctggcgaatatgacgaatccgag
gatgcacagatacgcaggcaggcgcgtatgttgcaggatctgggtgcggatgctctgaat
gccagcgactatttggagctgaagaacgccatcagtcagatgcaatcgaattatgccact
acgacagtttgctcctatacaaaccgcaccgattgcagcctaacgctggagccgcacatt
caggagcgtctgtccaacagccgtgatcccgccgagctggcctggtattggcgcgagtgg
tacgacaaagctggcacgcccatgcgcgagaactttgccacatatgtgcgattgacacgc
aaggcagcgcatctaaataactatcgctcctacgccgattactgggtgcacttctatgag
gatacagactttgagcgacagctggacgccacgtacaaggcactcttgccattctacagg
caaatccatggctatgtcaggtatcgtctgcgtcagcattatggacccgatgtggtgcca
gctgagggcaatataccgatgcatctgctgggcaatatgtgggcgcagtcgtggaacgat
gtcattgatctattcacaccttatccggagaaaccgtttgtggacgtcaaatcggaaatg
gaacgccaggagtacagcgtacagaagctcttccagctgggtgatcagttcttccaatcg
ctgggtatgcgagcactcccaccgaccttctggaacgctagtgtgctggagcgaccgctg
gatcgcgaagtcatctgccatgcgtcggcgtgggacttctatcaggacagcgatgtgcgt
atcaagatgtgcaccgaggtggacacccactatctgtatgtggtgcaccacgaactgggt
cacatacaatactatctgcagtatgagcaacagccagctgttttccgcggtgcccccaat
ccgggcttccacgaggctgtgggcgatgtgatcgcactctcggttatgtccgccaagcat
ctgaagagcattggtctcaccagcaatggacggctggacgagaagagccgcattaatgag
ctgtttaagcaggccctctccaaaattgtatttctgccatttggctatacgatggacaag
tatcgctatgctgtcttccgcaacgaattggatgagaaccagtggaattgcggtttctgg
cagatgcgttccgaatttggtggcgttgagccaccaatgatgcgcaccgacaccgacttt
gatccaccagccaagtatcatatcgatgccgatgtcgaatatttgcgctactttgcagcc
cacatattccagtttcagttccacaaggcgctgtgccggctggccggccagtatgtgccg
ggcgatagtcgccagacattggacaattgcgatatatttggcagcaagaaggctggcgag
gcattcaagaccttcttgtctgctggcaactcaaagcactggaaggaggtgctggaagag
ctcacaggcgaaacggaaatggatccagctgcattgctcgaatactttgatccgctctat
caatggctcaagctggagaacagccgtcttggtgtgcccttgggctggaacgagacgaac
aaaattccatccagttgctgtggagcatttagtacttaa

DBGET integrated database retrieval system