KEGG   Drosophila grimshawi: Dgri_GH12331
Entry
Dgri_GH12331      CDS       T01061                                 

Definition
(RefSeq) GH12331 gene product from transcript GH12331-RA
  KO
K16679  wengen
Organism
dgr  Drosophila grimshawi
Pathway
dgr04013  MAPK signaling pathway - fly
dgr04214  Apoptosis - fly
dgr04215  Apoptosis - multiple species
dgr04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dgri_GH12331
   04391 Hippo signaling pathway - fly
    Dgri_GH12331
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dgri_GH12331
   04215 Apoptosis - multiple species
    Dgri_GH12331
SSDB
Motif
Pfam: TNFR_c6 PhoR Comm
Other DBs
NCBI-GeneID: 6565220
NCBI-ProteinID: XP_001990979
FlyBase: FBgn0119810
UniProt: B4JJ51
LinkDB
AA seq 370 aa
MRTTTATTTRTTKATTRLERNISSKFHKRRRRRRSQQSTSGSTTTTTTAGAAARTTTVTR
RNSYPYLNKTGAYLTLLLLTTTCSLCAVATATTSNTATPASTATAAAASASALTSGSVSA
FVLPSSPCAPQHWWDQVQDKCTPCTSCQGEMIPLRPCQLHIDTVCGSIYDLKIDWVVLAK
TEPNWKERRKSSEYEHFDQATPLQHLSHEQLQQLHEEAAAALSLDWQTCALFIAMLACLL
FFTVAACILIHHMRQWRRMERRLDQDVEELSTKLMAKLAEVQSLDGGTFFIGNADALRGL
PASAMTAAAASASAQSGIFQPQHVLLPVEKHAKHQERRILKTLQPGNVYIEENNGIGTGG
GVGLLAGSKG
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcgcacaacaacagcaacaacaacacgaacaacaaaggcaacaacaagattagaaaga
aacataagctcgaaatttcataaacgccgacgaaggcggcgcagccagcagagcaccagc
ggcagcacaacaacaacaacaacagcaggagcagcagcaagaacaacaacagtaactaga
agaaatagctatccatatttaaataaaactggcgcctatttgacgctgctgctcctaacc
acaacatgttccttgtgcgctgtggccaccgcaaccacgtcaaatactgcaaccccagca
tcaactgcaaccgctgccgctgcctctgcctctgccttgactagcggtagcgtcagcgcc
tttgtgttgcccagttcaccgtgtgcgccgcagcattggtgggatcaggtgcaggacaag
tgtacgccatgcaccagctgccagggcgagatgattccgctgcgcccctgccagctgcac
atcgataccgtttgcggctccatctacgacctgaaaatcgattgggtggtgctggccaaa
acggagccaaactggaaagagcgccgaaagtcatcggaatatgagcatttcgatcaggca
acgccgctgcagcacttgagccacgagcagctgcagcagctgcatgaggaggcagccgct
gccctgtccctcgactggcagacatgcgccctcttcatcgcaatgctcgcctgcctgctc
ttcttcacggtggccgcctgcatactcatccatcatatgcgccagtggcgccgcatggag
cgccgtttggatcaagatgtagaagagttgtccacgaaactgatggccaagctggccgag
gtgcagagtctggatggtggcaccttcttcataggcaatgcggatgcgttgcgtggtctg
cctgcctcggccatgacggcggcggcggcgtcggcgtctgcgcagtcgggcatctttcag
ccgcaacatgtgctgctgcctgtggagaagcatgccaagcatcaggagcgacgcattcta
aaaacgctgcaaccgggcaacgtgtacatcgaggagaacaacggaatcggtaccggaggc
ggagttggacttctggccggctcgaagggctga

DBGET integrated database retrieval system