KEGG   Drosophila grimshawi: Dgri_GH12396
Entry
Dgri_GH12396      CDS       T01061                                 

Definition
(RefSeq) GH12396 gene product from transcript GH12396-RA
  KO
K09494  T-complex protein 1 subunit beta
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dgr03110]
    Dgri_GH12396
   03036 Chromosome and associated proteins [BR:dgr03036]
    Dgri_GH12396
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgr04147]
    Dgri_GH12396
Chaperones and folding catalysts [BR:dgr03110]
 Heat shock proteins
  HSP60 / Chaperonin
   Dgri_GH12396
Chromosome and associated proteins [BR:dgr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    Dgri_GH12396
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH12396
  Exosomal proteins of colorectal cancer cells
   Dgri_GH12396
  Exosomal proteins of bladder cancer cells
   Dgri_GH12396
SSDB
Motif
Pfam: Cpn60_TCP1 NAGLU_C
Other DBs
NCBI-GeneID: 6564754
NCBI-ProteinID: XP_001990899
FlyBase: FBgn0119875
UniProt: B4JIV9
LinkDB
AA seq 533 aa
MSLNPVRVLKNEAQEEKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGQVE
VTNDGATILRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLH
PQIIVAGWRVAAQAALNALTDAAQDNSSNNEKFKNDLLNISRTTLSSKILHQHKDFFANL
AVDAVLRLKGSGELKSIQIIKKSGGTLGDSFLDDGFLLDKKPGVHQPQRIENAKILIANT
PMDTDKIKVFGSSIKVDSLAKIADLEMAEKEKMKEKVDKILSHKCNVFINRQLIYNYPEQ
LFADAQVMAIEHADFDGIERLAYCTGGEIVSTFENPAMVKLGECNLIEQVMIGEDTLLRF
SGVKMGEACSIVIRGATQQILDEADRSLHDALCVLAATVKESRIIYGGGCSEALMANAVF
KKASETPGKEAIAIEAFARALLSLPTAIADNAGFDSAQLISELRASHAQGKHHLGLDMEQ
GKVADVRELGITESFAVKRQVLMSAAEAAEMILRVDDIIKCAPRRRVPDRGYC
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgtctttaaatcccgtgcgcgtactcaaaaatgaggcgcaggaggagaaagccgaaatg
gcgcgtctgtcgtcatttattggtgcgattgccattggagatcttgtgaagagtactttg
ggacccaagggtatggacaaaatcttggtggccaccggacgcaatgccggccaagtggaa
gtgaccaatgatggtgccacaattttgcgtgctgttggcgtcgataatccggctgccaaa
attctggtcgatatgtcgcgtgtgcaggatgaagaggttggcgatggcaccacatctgtc
accgtgctggcatccgaattgttacgcgaagccgaaaaactggtagaacagaaactgcat
ccacagatcattgtagccggctggcgtgtggctgcccaagcggcattgaatgcactgaca
gacgctgctcaggataattcgtcaaataatgagaaattcaagaacgatttgcttaatatt
tcacgcaccacattgtcctcaaagatcttgcatcaacataaggatttctttgcaaatctg
gccgtcgatgctgtgctacgtctgaagggatccggtgaactgaaatccatacagattatc
aaaaagtctggtggtacactaggtgattcgttcctcgatgatggctttctgctggacaag
aagcccggcgttcatcagcctcagcgcattgaaaatgcaaagattctcattgcgaacaca
ccgatggacactgacaaaatcaaagtatttggtagcagcatcaaagttgactcgttggcc
aagatcgccgacctggagatggctgaaaaggagaagatgaaagagaaagtagacaagata
ttgagtcacaaatgcaatgtattcatcaatcgccagctgatctacaattatcccgagcag
ttgttcgccgatgcccaagtaatggccatcgagcatgccgatttcgatggcattgagcgt
ttggcttactgcaccggtggcgaaattgtgtcaacctttgaaaatcccgctatggtcaag
cttggcgagtgcaatctcattgagcaagtgatgattggcgaggacacactgttgcgcttc
agcggtgtcaagatgggagaagcctgttccattgtcattcgtggcgccacccaacagatc
ctggacgaggctgatcgctcactgcatgatgcactctgcgtgctggcagccaccgtcaag
gagtcgcgcattatttatggcggaggctgctccgaggccctaatggccaatgccgtcttc
aagaaggcatccgagacacccggcaaggaagctattgccattgaagcatttgcacgtgct
ctgctatcgctgcccacagctattgcagacaatgctggctttgattcggctcaactgatc
tccgagctacgcgctagccatgcccagggcaaacaccatctcggtctggatatggagcag
ggcaaggtggctgatgtgcgcgaactgggcatcactgagtcctttgccgtgaagcgtcag
gttctaatgtctgccgccgaggctgctgaaatgattctgcgtgtcgacgacatcatcaag
tgtgcgccacgtcgtcgcgttcccgataggggctattgctaa

DBGET integrated database retrieval system