KEGG   Drosophila grimshawi: Dgri_GH13196Help
Entry
Dgri_GH13196      CDS       T01061                                 

Definition
(RefSeq) GH13196 gene product from transcript GH13196-RA
Organism
dgr  Drosophila grimshawi
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF819
Motif
Other DBs
NCBI-GeneID: 6566726
NCBI-ProteinID: XP_001993216
FlyBase: FBgn0120673
UniProt: B4JQG1
LinkDB All DBs
AA seq 276 aa AA seqDB search
MLSLKLVLVLLLQSSAIVLGGVCLIPEPVKRQRSLLDELWKTQPRLDGRIVGGQRINITN
APHQISLQTSAHICGGSLISEQWILTAAHCTEGKTANQLKVRLGSSEAARHGELLRVQKI
VQHEKFNYTNVDFDFSLLQLQHPIKFDESKKAIKLPEAEQMFMDGDPCFVTGWGNTQNLL
EPREWLRQVQVPLVNQQVCNDKYKQYGGITERMICAGYMEGGKDACQGDSGGPMVNEAGV
LVGVVSWGYGCAKPDYPGVYARVGYARDWIKEHSGI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcattgaaactggtgttagttctactgctgcagagcagcgccattgtcctgggc
ggcgtctgtttgataccagagcctgtgaagcgccaacgttcgctgctcgacgagctgtgg
aagacgcagccgcgtctcgatggccgcattgtgggtggccaacgtataaacataacgaat
gcaccacatcaaatctcgttgcaaacatcagctcacatttgcggcggatcactgatctct
gagcaatggattttaacagcggcccattgcaccgaaggtaaaacagcgaaccagttaaag
gtgcgtctgggcagctcggaagccgcgcggcatggagaacttctgcgcgtgcagaagatt
gtgcagcacgagaagttcaactatacgaatgtggatttcgatttctcgctgctgcagctg
cagcatcccatcaaattcgatgagtcgaagaaggccatcaagctgccagaggcggagcaa
atgtttatggacggtgatccgtgctttgtcaccggttggggcaacactcagaatctgcta
gagccacgtgaatggctgcgtcaggtgcaggtgccgctggtcaatcagcaggtctgcaac
gacaaatacaaacaatatggcggcattacggagcgcatgatttgtgctggttacatggag
ggcggcaaggatgcctgccagggtgactctggcggtcccatggtgaatgaggcgggcgtg
ctggtgggcgtggtctcatggggttatggctgcgccaagccagactatccgggcgtctat
gccagagttggctatgcacgtgattggatcaaggagcacagcggcatttag

DBGET integrated database retrieval system