KEGG   Drosophila grimshawi: Dgri_GH13998Help
Entry
Dgri_GH13998      CDS       T01061                                 

Definition
(RefSeq) GH13998 gene product from transcript GH13998-RA
  KO
K02358  elongation factor Tu
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dgr03012]
    Dgri_GH13998
   03029 Mitochondrial biogenesis [BR:dgr03029]
    Dgri_GH13998
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgr04147]
    Dgri_GH13998
Translation factors [BR:dgr03012]
 Eukaryotic Type
  Elongation factors
   Dgri_GH13998
 Prokaryotic Type
   Dgri_GH13998
Mitochondrial biogenesis [BR:dgr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dgri_GH13998
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH13998
  Exosomal proteins of breast cancer cells
   Dgri_GH13998
  Exosomal proteins of colorectal cancer cells
   Dgri_GH13998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 6569755
NCBI-ProteinID: XP_001996106
FlyBase: FBgn0121474
UniProt: B4JYK2
LinkDB All DBs
AA seq 462 aa AA seqDB search
MSTARLVRSMASSSSSKWQVNCGVSPQLLLTGNLQQYRVRQYANEKKVFERTKPHCNVGT
IGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTESRHY
GHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINK
VDAADQEMVELVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKNPEIGSEAILKLLQEV
DSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTV
TGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKEE
GGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKDMIMPGEDTKLILRLIRPMVLEQGQRFTL
RDGNLTLGTGVVTKVMPPLSETQRIELTEGKKAREKKVAAKK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcaagattggtgcgcagtatggccagcagcagtagcagcaagtggcaagtc
aactgtggtgtctccccccagctgcttctcacgggcaatttgcagcaatatcgggtgcgt
caatatgccaatgaaaagaaggtgttcgaacggaccaaaccccattgcaatgtgggcacc
attggtcacgtggatcacggtaagacaacgctaacggctgcaattaccaaggtgctggcc
gacaaacagttggcggagagcaagaaatacaatgaaatcgataatgcgcccgaagagaag
gcccgaggcattacaatcaatgtggcacatgtggaatatcagacggagtcacgacattat
ggccacaccgattgtcccggtcatgcggattacatcaagaacatgatcaccggcactgcc
caaatggatggcgccattctcgttgttgccgccacagatggtgccatgccacagacccgc
gaacacatgttgctggccaaacagattggcatcgatcatatagtggtgttcatcaataag
gtggatgcagcggatcaggaaatggtcgaactggtcgaaatggagatacgtgaactgctc
accgaaatgggctacgatggcgataagatacccgttgtcaagggttctgcgttgtgcgcg
ctcgaggacaagaatccagagattggctctgaggctattttgaaattgttgcaggaggtc
gatagctttataccgacaccagtgcgtgagctggacaaaccattccttttgcccgtcgag
aatgtgtattcgattccggggcgtggcactgtcgtcaccggtcgcctcgagcgcggtgtc
gtcaagaagggcatggaatgcgaatttgttggctacaacaaggtgctcaaatcaaccgtg
accggtgtggagatgttccatcagattctcgaggaggcccaggcaggcgatcagctgggc
gccttggtgcgtggcgtcaagcgtgatgacatcaaacgtggcatggtcatgtgcaaaccg
ggcagcgttaaagccctcgatcaattggaggcgcaagtctacatcctgtccaaggaggag
ggtggtcgcaccaaacccttcatgtccttcattcagctgcagatgttctcacgcacctgg
gactgtgcggttcaagtccaaataccggacaaggacatgattatgcccggcgaggacacc
aaactcatattgcgtctcatccgcccgatggtcttggagcagggtcaacgctttacgcta
cgtgatggcaatctgactttgggcacaggtgtcgtcaccaaggtcatgccaccgctgagc
gagacacagcgtatcgagctgacggagggtaaaaaggcgcgcgagaaaaaagttgctgcc
aaaaagtaa

DBGET integrated database retrieval system