KEGG   Drosophila grimshawi: Dgri_GH17114
Entry
Dgri_GH17114      CDS       T01061                                 

Definition
(RefSeq) GH17114 gene product from transcript GH17114-RA
  KO
K20014  cell death protein rpr
Organism
dgr  Drosophila grimshawi
Pathway
dgr04214  Apoptosis - fly
dgr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dgri_GH17114
   04215 Apoptosis - multiple species
    Dgri_GH17114
SSDB
Other DBs
NCBI-GeneID: 6558277
NCBI-ProteinID: XP_001985528
FlyBase: FBgn0124584
UniProt: B4J0M1
LinkDB
AA seq 67 aa
MAVAFYIPDQAKLLRKAREQEKQLLRLRQWQMATVMLNTIRQLMDSSASQCLQRAGRKCC
KWRKPSQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggccgtcgcattttatattccggaccaggcgaaactgttgcgcaaggctcgcgagcag
gagaaacagttgttgcgcctccgccagtggcagatggcaaccgttatgctgaacacaatt
cgccagctgatggactcctcggccagccagtgtctgcagcgggcgggccgcaagtgttgc
aagtggcgcaaaccatcgcaatga

DBGET integrated database retrieval system