KEGG   Drosophila grimshawi: Dgri_GH17120
Entry
Dgri_GH17120      CDS       T01061                                 

Definition
(RefSeq) GH17120 gene product from transcript GH17120-RA
  KO
K20016  cell death protein hid
Organism
dgr  Drosophila grimshawi
Pathway
dgr04013  MAPK signaling pathway - fly
dgr04214  Apoptosis - fly
dgr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dgri_GH17120
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dgri_GH17120
   04215 Apoptosis - multiple species
    Dgri_GH17120
SSDB
Motif
Pfam: Herpes_US9
Other DBs
NCBI-GeneID: 6558449
NCBI-ProteinID: XP_001985533
FlyBase: FBgn0124590
UniProt: B4J0M6
LinkDB
AA seq 419 aa
MAVPFYLPEGGADDIAASSSANSGASSSYPSTSSSSSSGVSSSSSGASSSASSSSGASSS
SGASDGASSVASQSPNTTTSATQTPMQSPLPMQTDHVLIALCEWYQHHQRNTSAPQIFQY
PPPPSPSCSIPQSPSFTSNDIFFAPGTPWPPRTPRTSISFAGVEDFNVYRQPYPVPAPST
PQPMPPQATLGPQSAPPLHYSHSYPQTSQQMLQHHPASYGQPLPAGAYFATYTPPPTPNT
ANASTSTSTSAFGSASAFCRHGYGTVMASTPLAPTGHKMRLQRSQSDAARRKRMTSTGED
EREYQSDHETSWDEFDDRYDNFTAGRERLQEFNGRIPPRKKKTSGGGGGGGGNTCNTHNS
NQSQTNESSQSQQRGRGREREREQSAKEKQKEKKQQSFTWPTVVTVFVFAMGCGFFAAR
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcagtgcccttttatctgcccgagggcggcgccgatgacattgccgctagctcatcg
gctaactcgggcgcctcctcctcttatccctccacctcctcatcatcctcatcgggtgtt
tcgtcctcctcatcgggcgcttcgtcctcggcctcatcctcgtcgggcgcttcctcgtcg
tcgggcgcatcggacggcgccagcagcgtcgcgtcgcagtcaccaaacacaaccacatcg
gccacgcagacgccgatgcagtcgccgctgccaatgcaaacggaccatgttttaatcgca
ctctgcgaatggtatcagcaccatcagcgcaacacttcagccccgcaaatctttcagtac
ccgccaccgcccagcccctcatgctcgataccccagtcgcccagcttcacaagcaacgat
atattctttgctcccggcaccccctggccaccacgcacgccgcgcaccagcatcagcttt
gccggcgttgaggatttcaatgtctatcgacagccgtatccggtgccggcgccatcgacg
ccacagccaatgccaccgcaagcgacgctgggtccgcagtcggcgccaccgttgcactac
agccacagttatccgcagacatcacagcagatgctgcaacatcatccggcctcctatgga
caaccgttgccagctggcgcctactttgccacctatacgccgccacccacgccgaacact
gcgaatgcctccacttccacctccacctccgcctttggctctgcctccgccttctgccga
cacggttacggcacggtcatggcatccacaccattggcgccaactggtcacaaaatgcga
ttgcagcgcagccaatcggatgcggctagacgcaagcggatgacctcgactggcgaggat
gagcgagagtatcagagtgatcatgagaccagctgggatgaattcgatgatcgctatgac
aattttacggctggacgcgaacgcctacaggagtttaatggacgcataccgccgcgcaag
aagaagacaagcggcggcggcggcggcggcggcggcaacacgtgcaacacgcacaactcg
aatcaaagccaaaccaacgaaagcagtcagagtcaacaacggggacggggacgggaacgg
gaacgggagcagtcggcgaaggaaaagcagaaggagaagaaacagcagagcttcacttgg
ccaacagttgtcaccgtctttgtgtttgccatgggctgtggcttttttgcagcgcgatga

DBGET integrated database retrieval system