KEGG   Drosophila grimshawi: Dgri_GH18429Help
Entry
Dgri_GH18429      CDS       T01061                                 

Definition
(RefSeq) GH18429 gene product from transcript GH18429-RA
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dgr01002]
    Dgri_GH18429
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgr04147]
    Dgri_GH18429
   04090 CD molecules [BR:dgr04090]
    Dgri_GH18429
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     Dgri_GH18429
Peptidases and inhibitors [BR:dgr01002]
 Metallo peptidases
  Family M1
   Dgri_GH18429
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH18429
CD molecules [BR:dgr04090]
 Proteins
  Dgri_GH18429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 6564062
NCBI-ProteinID: XP_001990086
FlyBase: FBgn0125897
UniProt: B4JEL7
LinkDB All DBs
AA seq 1989 aa AA seqDB search
MHITDNWLRVVLFWSVATTIVVAEQRTQEGKRTVFEEIDYRLPTALVPTHYSLHLHPELD
TGNFTGQERISIKVLEATNQIILHSHNLDLDSVYVLNNEVTSYELDELRQLLIINLQEEL
EVDAAITLGITFSGQMRNKLVGLYSSSYATPAGQQRNIATTQFQPTYARQAYPCFDEPAM
KATYNISVVHPTSGNYHALSNMNQVDTMLLGENTMASFATSVPMSSYLACIIVSDFDSET
STVKANGIGEDFEMRAFATPHQKSKVTFALGFGTAVTEYYIQYFKVAYPLPKLDMAAIPD
FALGAMEHWGLLTYRETALLYDEQISSTLDKQSVASVLAHEITHQWFGNLVTMNWWNDLW
LNEGFARFMQYKGVHAVHPDWGMLEQFQIIALHPVLVFDAKLSSHPIVQKVESPDEISAI
FDTISYDKAGSVLRMLETLVGPEKFELAVTNYLTKYSYKNTVTDDFLTEVAAQVSDFDVK
QLMRTWTEQMGYPVINVRQTDTGFLITQKRFLSNKASYDEEVEPSEFGYKWNVPITYLMD
NGYTDNLIFEYDVDEIGVAALSDINWIKLNVHQVGYYRVNYEESLWQKLIQELVEKHSRF
DIADRAHLLDDAFALADASQLSYTVPLEMTAYLADELDFVPWYVAASKLQTLKSHLMFTE
SYVSYLTYARTLLTNVYQEVGWTVDANNHLKNNIATTKFEPTYARQAYPCFDEPAMKATY
EISVVHPTSGNYHALSNMNQLDTMLLEENTIVRFATSVPMSSYLACIIVSDFDSETSTVK
ANGIGEDFEMRAFATPHQKSKVTFALGFGTAVTEYYIQYFKVAYPLPKLDMAAIPDFASN
AMEHWGLVTYRETALLYDEQISSTLNKQSVASVLAHEITHQWFGNLVTMNWWNDLWLNEG
FARFMQYKGVHAVHPDWGMLEQFQIIALHPVLVFDAKLSSHPIVQKVESPDEITAIFDTI
SYEKAGSVLRMLETLVGPEKFELAVTNYLTKYSYKNTVTDDFLTEVAAQVSEFDVKQLMR
TWTEQMGYPVINVRQTDAGFLITQKRFLSNKASYDEEVEPSEFGYKWNVPITYLMDNGYT
DNLIFEYDVDEIGVAALSDINWIKLNVHQVGYYRVNYEESLWQKLIQELVEKHSRFDIAD
RAHLLDDAFALADASQLSYTVPLEMTAYLADELDFVPWYVAASKLQTLKSHLMFTESYVS
YLTYARTLLTNVYQEVGWTVDANNHLKNNIASTQFEPTYARQAYPCFDEPAMKATYNISV
VHPTSGNYHALSNMNQLDTMLLGENTMASFATSVPMSSYLACIIVSDFDSETSTVKAYGI
GEDFEMRAFATPHQKSKVTFALGFGTAVTEYYIQYFKVAYPLPKLDMAAIPDFSSNAMEH
WGLVTYRETALLYDEQISSTLNKQSVASVLAHEITHQWFGNLVTMNWWNDLWLNEGFARF
MQYKGVHAVHPDWGMLEQFQIIALHPVLVFDAKLSSHPIVQKVESPDEISAIFDTISYDK
AGSVLRMLETLVGPEKFELAVTNYLSKYSYKNTVTDDFLTEVAAQVSEFDVKQLMRTWTE
QMGYPVINVRQTDAGFLITQKRFLSNKASYDEEVEPSEFGYIWSVPITYFMDNGESNSFI
LEYDNDIIGAKVLSDTNWIKLNVHQVGYYRVNYEESLWQKLIQELVEKHSRFDIADRAHL
LDDAFALADASQLSYTVPLEMTAYLADELDFVPWYVAASKLQALKNHLMFTESYVSYLTY
ARTLLTNVYQEVGWTVDANNHLKNRLRVSVLSAACALGVPDCLTQATNRFNTWLQNPTAA
NLPAPDLREVVYYYGMQQTSSESNWEQLLERFKAETDASEKLKLMYGLSAVQNGQLLYRF
LELASDENIVRSQDYFTCVQNIAANPVGQPIVWEYYREHWPQLVDRFGLNDRYFGRLIVS
ITSRFASDVKLEEVQHFFKKYPESGAGASPRQQAIETIKDNINWLKENAADISSWLSGTA
TPLNAKNPL
NT seq 5970 nt NT seq  +upstreamnt  +downstreamnt
atgcatataacggacaattggttgcgagtggtattgttttggagcgtggccacaacgata
gttgtcgccgagcaacgcacacaagaggggaagcgtacagtattcgaggagattgattat
cgtctgccgacggcacttgtgcccacgcactactctctgcatctgcatccggagctggat
acgggcaactttacgggccaggagcgcatctccataaaagtgttggaggcaacaaatcaa
atcattttacactcccacaacctggaccttgacagcgtttatgtgctcaacaatgaggtg
accagctatgagttggacgagctgcgtcagctgctgatcatcaacttgcaggaggagctg
gaggtagatgcagctattacgcttggcataactttttcaggacaaatgcgcaacaaatta
gttggattatacagcagcagctatgcgacgcctgcggggcagcagcgcaacattgcgact
acgcaatttcagccaacttatgcgcgccaggcatatccatgcttcgatgaacccgccatg
aaggccacctataatatcagcgttgtacatcccacttccggtaactatcatgcactgtcc
aacatgaaccaggtggacacgatgttactgggcgagaacacgatggccagctttgccacc
agtgtgcccatgagcagctatttggcctgtatcattgtctccgactttgactcggagacc
agcacggtgaaagcaaatggcattggcgaagacttcgagatgcgtgcctttgccactccc
catcagaagagcaaagtgacatttgcattgggatttggaacagctgtcacagagtactac
attcaatacttcaaggtggcgtatccacttcccaagttggatatggctgccattcccgat
tttgccttgggtgccatggagcactggggtctacttacatatcgtgagactgctctcctc
tatgatgagcagattagttccacgttggataagcagtcagtggctagtgtactggctcac
gagattactcatcagtggttcggcaatctggtcaccatgaactggtggaatgatctttgg
ctaaacgaaggattcgctcgcttcatgcagtacaagggcgtccatgctgtgcatcccgat
tggggaatgctggaacaatttcaaataattgcactacatccagttttggtgttcgatgcg
aaactctcctcacatcccattgtgcaaaaagtggagtctccggatgaaatatcggccatt
tttgatacgattagttatgataaagctggttctgtgttgcgcatgttggagactcttgtc
gggccagagaagtttgagttggctgttaccaactatttgaccaaatactcatacaagaac
acggtcaccgacgactttctgactgaagtggctgcccaggtcagtgactttgatgtcaag
caattgatgcgcacttggaccgagcagatgggctatccagttatcaatgtgcgtcaaacc
gataccggtttccttattacccaaaagcgattcctctccaacaaagccagctacgacgag
gaggtggaaccatctgaattcgggtacaaatggaacgttccaatcacttatttaatggac
aacggctatactgacaatttaatttttgagtacgacgttgatgagatcggagtggcagcg
ctatctgatatcaactggatcaagctgaatgtgcatcaggtgggttactatcgcgtcaac
tatgaggaaagtctgtggcagaaactcatccaagagctcgtcgagaaacattcgcgtttc
gacattgcggatcgggcgcatttgttggacgatgcctttgcattggccgatgccagtcag
ttgtcctacactgtcccactggagatgaccgcctacctagctgatgagcttgactttgtc
ccctggtacgtcgctgcctccaaactgcaaactctcaagagccatctcatgttcaccgag
agctacgtctcctacttgacttatgctcgtaccctgctcaccaatgtctaccaggaggtc
ggctggacggtcgatgctaacaaccatttgaaaaacaacattgcgactacaaaatttgag
ccaacttatgcgcgccaggcatatccatgcttcgatgaacccgccatgaaggccacctat
gagatcagcgttgtgcatcccacttccggtaactatcatgcactgtccaacatgaaccag
ttggacacgatgttactggaagagaacacgattgtcagatttgccaccagtgtgcccatg
agcagctatttggcctgtatcattgtctccgactttgactcggagaccagcacggtgaaa
gcaaatggtattggcgaagacttcgagatgcgtgcctttgccactccccatcagaagagc
aaagtgacatttgcattgggatttggaacagctgtcacagagtactacattcaatacttc
aaggtggcgtatccacttcccaagttggatatggctgccattcccgactttgcctcgaat
gccatggagcactggggtctagttacatatcgtgagactgctctcctctatgatgagcag
attagttccacgctgaataagcagtcggtggctagtgtactggctcacgagattactcat
cagtggttcggcaatctggtcaccatgaactggtggaatgatctttggctaaacgaagga
ttcgctcgcttcatgcagtacaagggcgtccatgctgtgcatcccgattggggaatgctg
gaacaatttcaaataattgcactacatccagttttggtgttcgatgcgaaactctcctcg
catcccattgtgcaaaaagtggagtctccggatgaaatcactgccattttcgatacgatt
agttatgagaaggctggttctgtgttgcgcatgttggagactcttgtcgggccagagaag
tttgagttggctgttaccaactatttaaccaaatactcatacaagaacacggtcaccgac
gacttcctgactgaagtggctgcccaggtcagtgaatttgatgtcaagcaattgatgcgc
acttggaccgagcagatgggctatccagtcatcaatgttcgccaaaccgatgccggtttc
cttattacccaaaagcgattcctctccaacaaagccagctacgacgaggaggtggaacca
tctgaattcgggtacaaatggaacgttccaatcacttatttaatggacaacggctatact
gacaatttaatttttgagtacgacgttgatgagatcggagtggcagcgctatctgatatc
aactggatcaagctgaatgtgcatcaggtgggttactatcgcgtcaactatgaggaaagt
ctgtggcagaaactcatccaagagctcgtcgagaaacattcgcgtttcgacattgcggat
cgggcgcatttgttggacgatgcctttgcattggccgatgccagtcagttgtcctacact
gtcccactggagatgaccgcctacctagctgatgagcttgactttgtcccctggtacgtc
gctgcctccaaactgcaaactctcaagagccatctcatgttcaccgagagctacgtctcc
tacttgacttatgctcgtaccctgctcaccaatgtctaccaggaggtcggctggacggtc
gatgctaacaaccatttgaaaaacaacattgcgtctacacaatttgagccaacttatgcg
cgccaggcatatccatgcttcgatgaacccgccatgaaggccacctataatatcagcgtt
gtacatcccacttccggtaactatcatgcactgtccaacatgaaccagttggacacgatg
ttactgggcgagaacacgatggccagctttgccaccagtgtgcccatgagcagctatttg
gcctgtatcattgtctccgactttgactcggagaccagcacggtgaaagcatatggtatt
ggcgaagacttcgagatgcgtgcctttgccactccccatcagaagagcaaagtgacattt
gcattgggatttggaacagctgtcacagagtactacattcaatacttcaaggtggcgtat
ccactgcccaaattggatatggctgcgatacccgatttttcatcgaatgccatggagcac
tggggtctagttacatatcgtgagactgctctcctctatgatgagcagattagttccacg
ctgaataagcagtcagtggctagtgtactggctcacgagattactcatcagtggttcggc
aatctggtcaccatgaactggtggaatgatctctggctaaacgagggattcgctcgcttc
atgcagtacaagggcgtccatgctgtgcatcccgattggggaatgctggaacaatttcaa
ataattgcactacatccagttttggtgttcgatgcgaaactctcctcgcatcccattgtg
caaaaagtggagtctccggatgaaatatcggccattttcgatacgattagctatgataaa
gctggttctgtgttgcgcatgttggagactcttgtcgggccagagaagtttgagctggct
gttaccaactatttgagcaaatactcctacaagaacacggtcaccgacgacttcctgact
gaagtggctgcccaggtcagtgaatttgatgtcaagcaattgatgcgcacttggaccgag
cagatgggctatccagtcatcaatgttcgccaaaccgatgccggtttccttattacccaa
aagcgattcctctccaacaaagccagctacgacgaggaagtggaaccatctgaattcggc
tacatatggagcgtgccaattacctattttatggacaacggggagtcaaatagtttcatt
ttagaatacgacaatgatataatcggcgcaaaggttctatccgatactaattggatcaag
ttgaatgtgcatcaggtgggttactatcgcgtcaactatgaggaaagtctgtggcagaaa
ctcatccaagagctcgtcgagaaacattcgcgtttcgacattgcggatcgggcgcatttg
ttggacgatgcctttgcattggccgatgccagtcagttgtcctacactgtcccactggag
atgaccgcctacctagccgatgagcttgactttgtcccctggtacgtcgctgcctccaaa
ctgcaagcgctcaagaatcatctcatgttcaccgagagctacgtctcctacttgacttat
gctcgtaccctgctcaccaatgtctaccaggaggtcggctggacggtcgatgctaacaac
catttgaaaaatcgcctacgggtttctgtcctttccgccgcctgtgctttgggagtacct
gactgcctgactcaggcaacgaaccgtttcaatacttggctccagaatcccaccgctgcc
aatcttcctgcgccagatctgcgtgaagtggtctactactacggcatgcagcagacgagc
agcgagtccaattgggagcagttgctggaacggttcaaggcagagacggatgctagcgag
aagttgaagctgatgtacggtctgtcggctgtgcagaatggtcagctgctctaccgcttc
ctggagctggctagtgatgagaatattgtgcgctcccaggactatttcacgtgtgtgcag
aatatcgctgccaatccggtgggtcaacccattgtatgggaatattatcgagagcattgg
ccacaattagttgatcgttttggcctcaacgatcgctattttggcagattgattgtgagt
atcacgagtcgatttgccagcgatgttaagctggaggaagtgcagcatttcttcaagaag
tatccggagtccggagccggtgccagtcccaggcaacaggcgattgagacgatcaaggac
aacattaactggctgaaggagaacgcagccgacatttccagctggctaagcggcacggcc
actccattgaacgcgaaaaacccattgtaa

DBGET integrated database retrieval system