KEGG   Drosophila grimshawi: Dgri_GH18913
Entry
Dgri_GH18913      CDS       T01061                                 

Definition
(RefSeq) GH18913 gene product from transcript GH18913-RA
  KO
K15279  solute carrier family 35 (GDP-fucose transporter), member C1
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dgr02000]
    Dgri_GH18913
Transporters [BR:dgr02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   Dgri_GH18913
SSDB
Motif
Pfam: TPT EamA DNA_processg_A
Other DBs
NCBI-GeneID: 6563906
NCBI-ProteinID: XP_001989656
FlyBase: FBgn0126380
UniProt: B4JH27
LinkDB
AA seq 337 aa
MYKNLEEHNRLVNKYLKIFFVVALYWCTSILTVFVNKHLLSSETVNLGAPLFMSWFQCVV
STVICLLMSCLSRKYPSVFTFPEGNPLDIDTFRKLLPLSVLYTLMIGANNLSLTYVTVAF
YYIGRSLTTVFSVVLTYVILRQRTSFKCLLCCATIVVGFWLGVDQESLTLAFSWRGTIFG
VLSSLALAMYSIQTKKSLSYVNQEIWLISYYNNLYSTLLFLPLIILNGELGTILAYQHLW
AGWFWAAMTLSGFCGFAIGFVTALEIKVTSPLTHNISGTAKACAQTVIATQYYNDVRSSI
WWISNIVVLLASAAYTRVKQLEMLQQHQQRNAATLKA
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtataagaatctagaagagcacaatcggttggtgaataaatatctaaaaatattcttt
gttgtggcgctctattggtgcacttccatattgacggtttttgtgaacaagcatctgctg
agcagcgaaacagtgaatttgggcgcacccttgttcatgtcctggttccaatgcgttgtc
tccacagtcatttgtttattgatgagttgcctgagccgcaagtatcccagcgtattcacc
tttccggagggtaatccactggacattgatacatttcggaagctgttgccgctatctgtg
ctctatacgcttatgattggtgccaataacttgtcgctgacctatgtgacggtggccttc
tactacatcggacgctccctgacgacagtgtttagtgtggtgctgacttatgtgattctg
cgtcaacgcaccagcttcaagtgcttattgtgctgtgcaacaattgtggtcggattttgg
ctgggtgtggatcaggagagtctaacgcttgccttttcctggcgtggcacaatcttcggt
gtgctcagctccctggcgctggccatgtactcgattcaaacgaagaaatcgctgtcgtac
gtcaatcaggaaatctggctaattagctattacaataatttgtattccacgctgttattt
ctgccattgattatactaaatggtgaattgggcacaattctggcatatcaacatttgtgg
gctggctggttttgggccgcgatgacgctgagtggattttgtggttttgccattggcttt
gtcacagctttagagataaaggttacttcgcctctaactcacaacatctctggcacggct
aaggcgtgtgcccaaacagttattgccacgcagtattacaacgatgtacgttcatcgatc
tggtggatctcgaatatagtcgtcttgctggctagtgccgcctatactcgcgtcaagcag
ctagaaatgttgcagcagcatcagcagcgcaacgcggcaacattaaaagcataa

DBGET integrated database retrieval system