KEGG   Drosophila grimshawi: Dgri_GH19419Help
Entry
Dgri_GH19419      CDS       T01061                                 

Definition
(RefSeq) GH19419 gene product from transcript GH19419-RA
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00010  Glycolysis / Gluconeogenesis
dgr00051  Fructose and mannose metabolism
dgr00052  Galactose metabolism
dgr00500  Starch and sucrose metabolism
dgr00520  Amino sugar and nucleotide sugar metabolism
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
Module
dgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH19419
   00051 Fructose and mannose metabolism
    Dgri_GH19419
   00052 Galactose metabolism
    Dgri_GH19419
   00500 Starch and sucrose metabolism
    Dgri_GH19419
   00520 Amino sugar and nucleotide sugar metabolism
    Dgri_GH19419
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dgri_GH19419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dgr04131]
    Dgri_GH19419
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dgri_GH19419
Membrane trafficking [BR:dgr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dgri_GH19419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 6564330
NCBI-ProteinID: XP_001990563
FlyBase: FBgn0126884
UniProt: B4JG58
LinkDB All DBs
AA seq 449 aa AA seqDB search
MAQQAQYPEAVEILQHFSLSEEKMHEIIHRLTKEMNMGLKKETHPRATVKCFVTYVQDLP
TGKERGKCLALDLGGTNFRVLLVTLKSETDVDTESKSYVISKALQEGPGKQLFDFIAECL
SDFCKEHKIEKDNIPLGFTFSFPCKQNGIDNGTLVAWTKGFQADGVVGKNVVELLREAIN
RRGDLKVKVVAILNDTTGTLMSCAFRERNCRIGMIVGTGSNACYVENTSNCETFEGYQTS
SKPNMIINCEWGAFGDNGVLDFVRTSYDKTIDLESVNPKKQIFEKSISGMYMGEAVRLIV
VELMEKGVLFKGRTSQTLQQKWIFNTRYITEIESDSPGHHRNAAMVLDQLGIRTTNERDL
ACLRFICEAVSVRSAKLAACGLVALINKMNAKDLVVGIDGSVYRYHPHYHALLMENMNLL
LKGSVKFQLMLSEDGSGRGAALIAAVSNK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacaggcacagtacccggaggcagttgagatcttgcagcatttctcgcttagc
gaggagaagatgcacgagattatccaccgtctgaccaaggagatgaacatgggcctgaag
aaggagacccatcccagagcgactgtcaagtgtttcgtcacttacgtgcaggacttgccg
acgggcaaggagcggggcaagtgtctggccctcgatctcggcggcaccaatttccgtgtt
ctgctcgtaacgctgaagagtgagacggatgtggatactgagtcaaagagttacgtgatc
agcaaggcgctgcaagaggggccgggcaagcaactattcgatttcattgccgaatgcttg
tcggacttttgcaaggagcacaaaattgagaaggataatattccgctgggattcaccttc
tcctttccgtgcaagcaaaatggcattgacaatggcaccctggtcgcctggacgaagggc
ttccaggccgatggtgttgtcggtaagaatgtggtcgagttgctccgggaggccatcaat
cggcgtggggacttaaaggtcaaagttgtggccatactcaatgatacgacgggaacgctt
atgtcctgcgcattccgggagcgcaattgccggataggcatgattgtcggcactggtagt
aatgcctgctacgtggagaacacgtccaattgtgaaacatttgagggctatcagacgagt
tccaagcccaacatgatcatcaactgtgagtggggtgcatttggggacaatggtgttctg
gactttgtgcgcacatcctacgacaagacgatcgacttggagtcagtgaatccgaagaag
cagatcttcgagaaatccatttcgggcatgtatatgggcgaggcagtgcgtcttattgtt
gtggaactgatggaaaagggggtcctcttcaagggaagaacatcgcagaccctgcagcag
aaatggatattcaatacccgttacataacggagattgagtccgattcgcctggtcatcat
cggaatgccgccatggtcttggatcaattgggcatccgcacgaccaatgagagggattta
gcctgtctgcgctttatctgcgaggctgtatcggtgcgctccgccaagctggcagcctgc
ggactcgtcgctcttatcaataagatgaacgccaaggatctggtggtgggcatcgatggc
agcgtttatagatatcatcctcattaccatgcgctgctaatggaaaatatgaatttattg
ctgaagggctctgtgaagtttcagctaatgctctctgaggatggttcaggacgtggcgca
gcactaatcgctgctgttagcaacaaataa

DBGET integrated database retrieval system