KEGG   Drosophila grimshawi: Dgri_GH20192Help
Entry
Dgri_GH20192      CDS       T01061                                 

Definition
(RefSeq) GH20192 gene product from transcript GH20192-RA
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dgr  Drosophila grimshawi
Pathway
dgr03030  DNA replication
dgr03410  Base excision repair
dgr03420  Nucleotide excision repair
dgr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dgri_GH20192
   03410 Base excision repair
    Dgri_GH20192
   03420 Nucleotide excision repair
    Dgri_GH20192
   03430 Mismatch repair
    Dgri_GH20192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dgr03032]
    Dgri_GH20192
   03400 DNA repair and recombination proteins [BR:dgr03400]
    Dgri_GH20192
Enzymes [BR:dgr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dgri_GH20192
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dgri_GH20192
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dgri_GH20192
DNA replication proteins [BR:dgr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dgri_GH20192
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dgri_GH20192
DNA repair and recombination proteins [BR:dgr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dgri_GH20192
   NER (nucleotide excision repair)
    Other NER factors
     Dgri_GH20192
   MMR (mismatch exicision repair)
    Other MMR factors
     Dgri_GH20192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 6559920
NCBI-ProteinID: XP_001987033
FlyBase: FBgn0127656
UniProt: B4J642
LinkDB All DBs
AA seq 674 aa AA seqDB search
MDEPMEPLPSKQKIISLTSDSNESEGTDIYNPSLELYHPINHAYWRAEGVTPYLALARTF
QVIEETKGRLKMIDILSNFFCSVMMVSPEDLVPCVYLSINQLAPAYEGLELGVAETTLMK
AICKATGRNLAHIKSQTQLIGDLGIVAEQSRVSQRMMFRPKPLNVRAVFAKLKEIANISG
QSKITLVYDIFVACRLSEARFFIRSLIGKLRIGIAEQSLLTALAIALVKKLHINDCKRID
KVAEIYKDEIAETTLILKTTFCQCPNYDIIIPAILKYDIEELQERCPMHPGMPLRPMLAQ
PTKGVHEVLERFSGMHITCEWKYDGERAQIHLNEQGEISIFSRNSENNTPKYPDLIARSK
PILKTEVKSYILDSEIVAWDIERKQILPFQILSTRKRKNVDIDDIKVQVCVYIFDLLYIN
GKSLVTQPLSERRKILFEHFQEVEGEWKFATALNTNDMDEVQQFLEESIKGNCEGLMVKT
LDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGIYGGFLLACYDTD
NEEYQTICKIGTGFTDEDLRQHSEFFSTNKLSEAKSYFRYDSSLEPDDWFEPCQVWEVKC
ADLSLSPIHRAGIGIVDAERGISLRFPRFIRIRDDKSPENATDANQVAHMYSSQDVVKNN
QKSSNSMDLESDFY
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcccatggaaccgctgcccagcaagcagaaaattattagcttaacttcagac
tcgaatgagagcgagggaactgatatatacaatccgtcattggaattatatcatcccatt
aatcatgcatactggcgagccgaaggcgtaactccttatttggcgctggcccgaacattt
caagtgattgaggagacgaaaggccgattgaaaatgattgatatattgagcaattttttt
tgctcggtaatgatggtcagtccagaagatctggtgccgtgtgtctatctcagcattaat
cagttggcccccgcctacgaaggactcgaacttggcgttgccgaaacaacgctgatgaag
gcaatttgcaaagcaactggtcgcaatttggcgcacattaaatctcagacacagttaatt
ggcgatcttggaattgtcgcggagcaatcgcgcgtctcgcaacgcatgatgtttcgccca
aagccattgaatgtgcgcgctgttttcgccaaactcaaggagattgcaaacatttcaggg
cagtcgaagattactttggtttatgatatctttgttgcctgtcgcctgtcggaagcacgt
ttctttattcgctcgctaattggcaaattgcgtataggcattgccgagcagagcctttta
actgccttggccattgctcttgttaaaaaacttcacatcaacgattgcaaacgtatcgac
aaagtggccgaaatttataaagatgaaattgcagagactacgctgattttaaaaacaact
ttctgtcaatgtcccaattatgacatcattataccagcaatattaaaatatgacattgag
gagctgcaagagcgttgtcccatgcatcctggcatgcctcttagacccatgctggcgcag
ccaacaaaaggtgtccacgaggtcctggaacgttttagtggaatgcatataacttgcgaa
tggaagtatgatggcgagagggctcaaattcatttgaatgagcagggcgagataagcatt
ttctcaaggaactcggagaataatacacccaaatatccggatctcattgcaagaagcaag
cctatccttaaaactgaggtgaagtcgtatatcctcgatagtgagattgtcgcctgggat
atagaacgcaagcaaattctaccattccaaattcttagtacacgtaaaaggaaaaacgtt
gatatcgatgatataaaagttcaagtttgtgtgtacatatttgatcttttgtacatcaat
ggaaagtccctagtcacacagccactttctgagcgtcgaaagatactatttgaacatttc
caagaagtcgaaggtgaatggaaattcgccactgccctcaacacaaatgatatggatgaa
gtgcagcaatttttagaggaatcgattaaaggcaactgtgagggtctaatggtgaaaaca
ttggatgaggaggccacatatgaaattgcaaaaagatcaagaaattggctgaaattgaaa
aaagattatttgtcaaatgtgggtgattctctggatctggttgttatcggtggctacaag
ggcaaaggacgacgtaccggaatctacggtggcttcctgctagcctgttatgacacagac
aatgaggaataccaaaccatatgcaaaattggaactggtttcactgatgaagatttgcga
caacactctgagttctttagcaccaacaagttgagcgaggccaaatcatatttcagatac
gattccagcttggagccggatgattggtttgagccctgtcaagtttgggaggttaaatgc
gccgatctatcgcttagtcccattcaccgagcaggtataggaattgtggatgctgaacgt
ggtatttcgctgcgatttccccgttttatacgcatccgagatgacaagagtccagagaat
gcaacggatgcaaatcaggtggcccacatgtatagctcacaggatgttgttaaaaataat
cagaaatctagcaactcaatggatcttgagagcgatttttattaa

DBGET integrated database retrieval system