KEGG   Drosophila grimshawi: Dgri_GH20303
Entry
Dgri_GH20303      CDS       T01061                                 

Definition
(RefSeq) GH20303 gene product from transcript GH20303-RA
  KO
K03260  translation initiation factor 4G
Organism
dgr  Drosophila grimshawi
Pathway
dgr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Dgri_GH20303
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dgr03019]
    Dgri_GH20303
   03012 Translation factors [BR:dgr03012]
    Dgri_GH20303
Messenger RNA biogenesis [BR:dgr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dgri_GH20303
   mRNA cycle factors
    Stress granule specific factors
     Dgri_GH20303
Translation factors [BR:dgr03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    Dgri_GH20303
SSDB
Motif
Pfam: MIF4G W2 SUIM_assoc FANCI_S3
Other DBs
NCBI-GeneID: 6559178
NCBI-ProteinID: XP_001986857
FlyBase: FBgn0127767
UniProt: B4J518
LinkDB
AA seq 1591 aa
IKIITIPLSTYDAAPLLHTYDDSPPQRWANGTSNGHQAGVIIDQFRQCAKTITIEGGTST
GDTTSIGGGVNDLRLVITAQQNDIIERNYDQLTNRGGGGGGGGAVIGVTSSSSTNSSGGG
QTPPTPQSATAATTTTASALGQKTLLNTSPNLLPITTATDTFNNLKNLVKIDKGTTNSTG
NNYRANKSGNDSLLATRNGSRTSVGGSAGGGGVGASSAISGVGAGQVGGPSGHFSTGYNK
NSVKIRQHDSELSPRPRRSYQNDSSSSSRYYNKNSDILGASGNNNNNNNGGGGGGSQQPG
LNADSSSSNYNGSGLGVHRGSRNNYHTNSSDGGGSYNRNLNTNSGSNYRSSNSSSRYETL
NGNGNTGSHNSNTSSSSSGQQQQQQQQQQRHYGNSGNAGSNNTSSSVGGGNPNKSNYASQ
RNDGNSSLSGGRYRDDYTSNSRDNYRERERDNREQSYAEDRYGGSSLERNGHAANRYSSN
RGNNDERYERAGQSSIRSGNSGAQHQQQQQHQQQQQQQQQQLPAKSATPPPSGAGATGGA
QQQQQQQQQQQITGRWIPPSLRPQHGLTQSEKNDAVFRRVRGILNKLTPEKFQELSDELL
KLDLNSIAILNGVILLIFDKALDEPKYSSMYAQLCKRLSEEAPFEKEPNNSCTFLRLLIA
VCRDKFNNRLKRDEANDNRPPPENEADEEERRHLAKQRMLGNVKFIGELNKLDMLSNNVL
HACIMELLDKKKKRTAGAQEMCEDMECLAQLLKTCGKNLDSEQVKELMNQYFKTLERRSQ
STEYPPRIRFMLKDVIELRQNHWIPRKVGGSAEGPVPIKQIRSDDDSIIRTPFANRNRDM
RNNDRDGDSWMNRFHLNIQPGGYNDMFSGLSVTGASPIVSPFVTSNNRDRDRDNRQYNNR
DRNNRDQGGNNGGNNGGGGGGNYNNRYNNKHSSQNGGAGGQGGGSGGGNRDDSRGGNGGS
HRNNDRNNDRNNDRNNDGQYGGSNQMLLGKELAPRFKRNMITANQDSVENLQMRPAANSL
LFRAASQNQKFPATLPISTPPSGNSSQHQQQQSTSQLSNSHYPLLGTPTSHLMNTPTRPS
STPSAEYGAENRTLHTAQQQAEKSLKATSSSPNFGTATAVAENNAEKKTANGAAAGVGEN
KEQPSGGSSKNGAAERPTTPSGSTTAAGGSSKQQKKDKGPSKEELNKKAIVYFKDKFYYD
EQKDDETTTTIPPIITEGATQEEAENETETETTTTTTLDEETTKTDQFTELVDGFIELKL
PEKSLKDVCLNLLMEVLDRVNDVYLERIVRFLQALRKQSVIKPNVIVEIFKQLVNKMNER
EALNPRITALVASVLCKAVCEPALIKLTDIANFTDNGQHYPLFLLVLQQLHKTIGKDALE
EKFRASKIDLMNSLQEVDRNKERLGEILEDRQLSFLYPLLKVQAEMLKQLQGDPNPNSFY
KWIKANVDNKYYKDPGFIQALMTVVVKYITKETTLASNMDPKEHPEKSVTQREQAMLETY
SQMLQTFLGQNELQLMALYALQLLCYNENFPKGMLCRWFKYLYDSEIIEEEAFVLWKEEI
SDKYPGKGSALFQVNAWLTWLQEAESEDDED
NT seq 4776 nt   +upstreamnt  +downstreamnt
ataaaaattatcaccattccactatcaacgtacgacgccgctccccttttgcacacttac
gacgatagtccgccgcaacgttgggctaacggtactagcaacgggcatcaggcaggcgtc
atcatagatcagtttcgccagtgcgccaaaacgatcaccattgagggaggcaccagcacc
ggtgacacgacgagcatcggcggcggcgtcaacgatttgcgtttggtaataacggcccaa
caaaacgatatcatcgagcgcaattacgatcaattgaccaatcgcggcggtggaggcgga
ggcggcggcgccgttataggcgtcaccagcagcagcagcaccaacagcagcggaggcggc
caaacaccaccgacaccacaatcagcaacagcagcaaccacaacaacggcgtcagcattg
ggacaaaaaactctgctcaataccagtccaaatcttttacccattaccactgccaccgat
acgttcaataatttgaagaatctggttaaaatcgataagggtacgaccaattcgacgggc
aacaattatcgtgcgaataaatctggcaacgattcgctgttggccacacgcaacggtagt
cggacaagtgttggaggatcagcaggtggtggtggtgttggtgcatcatcagcaataagc
ggagtaggtgctggacaagttggtggcccaagcggacacttttccactggctataataaa
aattccgtcaaaattcgtcaacacgattcggagctaagcccaaggcctcgacgatcatat
caaaacgattcgtcgtcgtcgtcgcgttactataacaaaaatagtgacattttgggtgca
agcggcaataataacaacaataacaacggcggtggcggtggcggcagtcagcagccaggt
ttaaacgctgatagctccagcagcaactataacggcagtggtcttggagtccatcgtggt
agtcgcaacaactatcacacaaactcctccgatggcggcggcagctataatcgtaatcta
aacaccaattcgggcagcaactatcggagcagcaacagcagctcacgctacgagacacta
aatggcaatggcaacactggcagccacaacagcaacaccagcagcagcagcagtggacag
cagcagcagcaacaacaacaacagcagcgtcactacggcaacagcggcaacgcgggcagc
aacaacacctcatcatctgttggtggcggtaatccgaacaagtcaaattacgcatcgcaa
cgcaacgatggcaacagcagcctgagcggcggacgctatcgcgacgactataccagcaac
agccgtgacaactatagagaaagggagagggacaacagagagcagagttacgcagaggat
cgctacggtggcagtagtctagaacgcaacggacacgctgccaatcgttatagcagtaat
cgaggcaacaacgacgagcgttacgagcgtgctggccaaagcagcattaggagcggcaac
agtggagcacagcatcagcagcagcaacaacatcaacagcaacaacagcagcagcaacaa
caattgccagccaagtcggcaacaccaccgcctagcggtgcaggagcaactggaggcgct
caacaacaacagcagcagcagcagcaacaacagataactggccgctggataccgccatca
ttgcgtccacagcatggcctcacccagagcgaaaagaatgatgctgtgtttcgacgtgtg
cgtggcatcctcaacaaactaacaccggagaaattccaagagctaagcgatgaactactc
aaactcgatctgaattcaattgccattttaaatggtgtcattctgctaattttcgataaa
gccttggacgagccgaaatactcgtctatgtatgcacagctgtgcaagcgtctgtccgag
gaagcgccgtttgaaaaggaaccaaacaattcgtgcacctttctgcgtctgctcatcgcc
gtctgtcgcgataagttcaacaatcgcctgaagcgcgacgaggcgaacgataatcgtcca
ccgcccgagaatgaggctgacgaggaggagcgacgccatctggccaagcagcgcatgctc
ggcaatgtcaagttcattggtgagctcaataagttggatatgctatcgaacaatgtattg
catgcgtgcattatggagctattggataagaagaagaagcgtacggccggtgcgcaggag
atgtgcgaggacatggaatgcctggctcaattgctcaagacttgcggcaagaatttggat
tcagaacaggtcaaagagctgatgaaccagtactttaagacgttggaacgtcgttcacag
tcaactgaatatccgccaaggatacgcttcatgctaaaggatgtcatcgaactgcgccaa
aatcactggataccccgtaaagttggcggcagcgccgagggacccgtccccataaagcaa
atacgctcggacgatgactcaataatacgcacaccattcgccaatcggaatcgcgatatg
cgcaacaatgatcgcgacggcgacagctggatgaatcgattccatctcaacatacagcca
ggcggctacaatgacatgtttagcggcctgagcgttacgggagcatcacccatcgtatca
cccttcgtgaccagcaataatcgggatcgggatcgtgacaatcgtcagtacaacaatcgt
gatcgcaataatcgtgaccagggtggcaacaacggtggcaacaatggcggcggcggtggt
ggcaactacaataatcgctacaacaataagcacagcagtcaaaacggaggcgctggtggc
cagggcggcggcagcggcggcggcaatcgcgacgattcacgtggcggcaatggtggctcg
catcggaacaatgatcggaacaacgatcgcaataatgatcgcaacaacgatggccaatac
ggtggcagcaatcagatgctccttggcaaagagttggcgccgcgtttcaagcgcaatatg
atcacagcgaatcaggattcggttgagaatctgcagatgcgtccggcagccaactcgttg
ctgttccgcgctgcctcccaaaatcagaaattcccggccacattgccgatctcaacgccg
cccagcggcaattcctctcagcatcagcagcagcagtccacatcgcagctatccaattcg
cattatccactgctcggcacgcccacatcacatctaatgaacactccaacgcgaccatcg
tccacaccatcggctgaatatggcgcagagaatcgcacgctacacacggctcagcagcag
gcggagaagagcctcaaggcaacatcttcgtcgcccaactttggcacagctacagcagtc
gcagaaaataacgcggagaagaagacagcaaacggtgccgcagcgggagttggcgagaac
aaggagcagccaagcggtggcagctcaaagaatggtgccgccgagcgccccacaacgcca
tctggctcaactaccgcagctggtggttctagcaagcaacagaagaaggacaagggaccc
agcaaggaggaactaaacaagaaggcaattgtctactttaaggataaattctactatgac
gaacaaaaagatgatgaaaccacgaccaccatccccccaataataactgaaggagcaacc
caagaggaagctgaaaacgaaaccgaaaccgaaactacgacaacaacaacattggatgag
gagacaactaaaaccgatcaatttaccgagctagttgatggtttcattgaattaaaactg
ccggagaaatcgcttaaggatgtatgcctcaatctgctgatggaggtgctggatcgtgtg
aacgatgtttacctggagcgtatcgttcgcttcctgcaggcattgcgcaagcaatccgtc
attaagccgaatgtgatcgttgagatcttcaagcagttggtcaacaaaatgaatgagcgt
gaggcgctgaatcccaggattaccgccctggtcgcctcggtgctgtgcaaagcggtctgc
gaaccggcattgattaagctaactgatatcgccaactttacggacaatggacagcattat
ccattgtttttgctggtgctgcagcaactgcataaaacgattggcaaggatgcgctcgag
gagaagttccgtgccagcaaaattgatttgatgaacagtctacaagaggtggatcgcaac
aaggagcgactgggtgaaatacttgaggatcgacagctatcgttcctttatcccctgctc
aaggtgcaggctgagatgttgaagcagctgcagggtgatcccaatccgaatagtttctat
aaatggatcaaggccaatgtggacaacaaatactataaggatccgggcttcatacaggcc
ctcatgactgttgtggtcaaatatataaccaaggagacaactctggccagcaacatggat
cccaaggagcatcccgagaagtctgtcacacaaagagaacaggccatgctggagacctat
agccaaatgctgcagaccttcctcggccaaaacgaattgcaactgatggcactctatgcc
ctgcagctcctctgctacaacgagaacttccccaagggcatgctgtgtcgctggttcaaa
tatctgtacgattccgagatcatcgaggaggaagcattcgttttgtggaaggaggagatt
tctgacaaatatcccggcaagggctcggcattgttccaagtgaacgcctggttgacttgg
ctacaggaggccgaatctgaggacgatgaggattaa

DBGET integrated database retrieval system