KEGG   Drosophila grimshawi: Dgri_GH20410Help
Entry
Dgri_GH20410      CDS       T01061                                 

Definition
(RefSeq) GH20410 gene product from transcript GH20410-RA
  KO
K02178  checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dgr01001]
    Dgri_GH20410
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dgr03036]
    Dgri_GH20410
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dgri_GH20410
Protein kinases [BR:dgr01001]
 Serine/threonine kinases: Other
  BUB family
   Dgri_GH20410
Chromosome and associated proteins [BR:dgr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     Dgri_GH20410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mad3_BUB1_I Pkinase Pkinase_Tyr Kinase-like Kdo Mad3_BUB1_I_2
Motif
Other DBs
NCBI-GeneID: 6560139
NCBI-ProteinID: XP_001986644
FlyBase: FBgn0127873
UniProt: B4J9U7
LinkDB All DBs
AA seq 1572 aa AA seqDB search
MDFDNAKENIQPLASGRNVCLLQASLTQDASQELSAQRKQLELNINNYKGDDPLEPWYAY
ICWIEQSYPAGGTNCGLQKVMQKCLTRFEQDERYKQDQRLIKLFIKFMGNQGDQIECYQQ
MYNSGIGTMLADFYIAWAYSYDLSGNMRKANEIFRLGIECRAQPLEKLKEAQLHFGYTVA
QRLLYNEGEIADVTQELNDRRLALRSLHGQKRENTVTVGSVRTGAAVKSNTPGVVQNSGP
STSRASRNPNRQLAVFNDENADVNVPPTEQPAASEAEAVAEGKSSLRSIIDATRQQENLK
ETIAWSKPHKHGRIFGSTAAHDPAFAIHVDEKTHPPIIDPEGNDIKPFKSPANFVPKNVP
QTAWVTPVTIEDEPDGNTLPCYNKCMLYPRPNMEFSPEEYRAYCWLKSRSDQHPYVLRNE
SWWSNGPAYGVRRYPNFASVSKPQARDELDAYYKPPVAPSITTLLDKIYNDEQQQEYQLE
ELVAKWRQKERAAQGVADMEETVCLPGEQMPRRKSFFPAMQPGSSRKSVMPRISCLREEE
EDEEEELQQQEQTEPVAKPKTPDPVANQIWVDPAAATTETLTPTQIPIETAITTAAPSAA
SPMEDKFVMPAPPTRKIEIFEDEVMPPPQSAVKPASSGFFDADETCSTQMFNIFIKSQAV
STPKAPQKQQSTRQFGTILKETPVAAPPTPTTEEHAELEAAPVGSPILRKQLSTILETSE
HAIGGSTKSTLTSNASASPGSQLTGKSEALQGGECTPGPTRLQRQLSIVGEEMPSITDPA
SAGNFQRPEMWEPNAPSVPLLKSLRFQEDKTETVTRPLLSCFQDDKTETLPRLPLTIPNT
PMHQRMAQPSVPQLPTQSDEDDICGLFAQSPPMSKAFDSPLYAASSKRFCNQQTPNQMSK
TRKQAEQPKRNCFEVFDDQEYSLPVAKASINKLADSFMADLSFVPETQLPPKSQATVQKK
LEIFLDDTMPPPPPPEVPPLMNFTLPETQPDVEVLGPAHLTASFMKDCTQLSICPIPDKS
QTTNKFDVFRDESNPLLLPPLPPLPIVILDCTLPETQPEGRGAAAAVVEQLETIGPAHLT
ASFMNDFTELSKCPSTSSSTSTAKTAETKRKFLQESNSQAESEKQSGDYFELNAATEMFA
SNNSMIKNSTVLPEASRGKPSKSPVHRRQPGPTIIIEETIGNDLDDRSIYYKKTPLTPKQ
SSHNSWHESMPNENFEHRKASVDESVLNETLASRNVNPFSMDVINSLLDSIEFSLYIEKL
PNCQLQGHVQRLKPQSTLEVNGDRFEVDKMIGKGAYGSIFSGIHCKSGKKVAFKQEKPTN
YWEYYICLEVHSRLASEEMLPAYMHIDYALVGNNSSVYIMELSTYGSLICVCNKYKKHTT
KNLDEYIVMHLCCQLLDIVDHLHALGIIHADIKADNFLLTRPLSGQPNELSVQLIDFGVA
IDTKLFPPNQTFDYVNNEDAFKCIEMRTQRRWTYQLDLFGLVGVMHVLLFGSYMEVTQRQ
AGGVWMPKTAIPRYFHRQTWESIFRTLLNVRDCRSMPNLQELRTLLKSDLAENEKCAEAA
IAKFNMIMKSTN
NT seq 4719 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgataatgccaaggagaacatacagcccttggccagtggacgcaatgtgtgc
ctcctgcaagcctcgcttacccaagacgcctcccaagagctgagcgcacagcggaagcag
ctcgagttgaatataaacaattacaagggtgacgatccgttggagccgtggtatgcctac
atatgctggattgaacagagctatccggcgggcggcaccaattgcggcctgcagaaggtc
atgcagaaatgcctcacccgcttcgagcaggatgagcgctataaacaggaccaaagactt
ataaaactcttcattaaattcatgggcaaccaaggcgatcagattgagtgctatcagcag
atgtacaacagcggaattggcaccatgctggccgatttttatatagcctgggcctatagc
tacgatctgagtggcaacatgcgcaaagcaaacgaaatctttcgcctcggcatcgaatgc
cgtgcccagccactggagaagcttaaggaggcccaactgcacttcggctatacggttgcc
cagcgcttactttataacgagggcgagatagccgatgtcacacaggagctcaacgatcgc
cgtttagcgctgcgctcgctgcatggccagaagcgtgagaacaccgtcacagtgggcagc
gtacggacgggagctgctgtcaaaagtaatacgcccggcgtggtgcaaaactctggaccc
agcacgagtcgagccagtcgcaatcccaaccgtcagctggcagtattcaatgatgagaat
gccgatgtgaacgtgccgccaacggagcagccagctgctagtgaagcagaggccgtagct
gagggcaaatccagtttacgttcgattattgatgcgacacggcaacaggagaatctcaag
gaaaccattgcgtggagcaaaccgcacaagcacggcaggatctttggctcgacggctgca
catgatccggcctttgccatacacgtggatgagaagacacacccgcctatcattgatccc
gagggcaacgacattaagccctttaaaagtccagcgaactttgtaccgaagaatgtaccc
cagactgcttgggtgacgcctgttacaattgaggatgagccggatggaaatacgttgccg
tgctacaacaaatgcatgctgtatccacgtcccaacatggagttctcgccggaggagtat
cgtgcctattgctggctcaaaagtcgcagcgatcagcatccctatgtcctgcgcaacgaa
tcatggtggagcaatggtccagcttacggtgtccgtcgctatccgaactttgcaagcgtc
tccaagccacaggcacgcgatgagctggatgcctactataagccgcctgtggcaccatct
ataaccacattgctggacaagatctacaacgatgagcagcagcaggagtatcagctggag
gagctggtggcaaagtggcgacagaaggaacgcgctgctcaaggcgtcgcagacatggag
gagacggtgtgtctgccaggtgaacagatgccgcgacgaaagagcttcttcccagccatg
cagccaggatctagtagaaaatccgttatgcccagaatatcgtgtttgagggaagaggag
gaggatgaagaagaggagctgcagcagcaagagcagactgaaccggttgccaagcccaaa
acacctgatccagtggccaaccaaatatgggtagatcctgcagcagctacaactgaaact
ctaactccaactcaaattccaattgaaactgcaattacaactgctgctccaagtgcagca
tcacctatggaggataaatttgtaatgccagcgccgcccacacgtaaaatagaaatattt
gaggatgaggtgatgccgccgccacaatcggcagtaaagccagcttcgagcggattcttc
gatgcggatgaaacgtgctccacgcaaatgttcaacatattcattaaatcgcaggcagtg
agcacacccaaggcgccacagaagcaacagtcaacgcgtcaatttggcaccatactcaag
gagacgccagtggcggctccaccgactccgaccactgaggagcacgcggagttggaagcg
gcacctgtgggttcgcccatactgcgcaagcagctctccaccatactggagacatcggag
catgccattggtggcagcaccaaatcgacgctcacatcgaatgcctccgcttcgcccggt
tcgcagctgacgggcaaatcggaggcattgcagggtggcgaatgcacgccgggcccgacg
cgactgcagcgtcaactatccatcgttggcgaggagatgccttccattaccgatcccgct
tctgctggcaactttcagcggccggagatgtgggagccgaatgcgcccagtgtgccatta
ctgaaatcgttgcgattccaggaggataaaactgaaacggtgacccgtccactgttatcc
tgctttcaggatgataaaaccgaaactttgccccgactgccattgaccataccgaacaca
ccgatgcatcaacggatggcgcagccatcggtgccacagctgccaacgcagagcgatgaa
gatgacatttgcggcctgtttgcccagtcgccgccaatgtccaaggcatttgattcacca
ctctacgcggccagctcgaagcgcttttgtaatcagcagacgccgaaccagatgagtaag
acaaggaagcaagctgagcagcccaagcggaattgctttgaggtgtttgacgaccaagag
tactcgctacctgtggccaaagccagcattaacaaattggccgactcatttatggctgat
ttatcctttgtgccagagacgcagttgccgccaaaaagtcaagcgactgttcaaaagaaa
ttggaaatctttttggatgatacaatgccgccacctccgccgccagaggtgccaccactg
atgaacttcacattaccggaaactcaaccagatgtggaagttcttgggccggcgcacttg
actgcctcgtttatgaaggattgcacgcagctaagcatctgccccatcccggataagagt
caaacgacaaacaagttcgatgtatttcgggatgagtccaatccactcctactgccgccg
ctgccgccgctgccaatcgtcatattggattgcacattgcccgaaacgcagccagaagga
cgaggagcagcagctgctgttgtcgagcagctggagaccatcggacccgctcatctgacc
gcctcgtttatgaatgatttcacagagctaagcaaatgcccctcaacgtcttccagcaca
tcaacagcaaaaacagctgaaacaaagcgcaagtttcttcaggaatcgaactcacaggcg
gaatcggagaaacagtctggcgattactttgaactaaatgcggcgaccgaaatgtttgcg
agcaacaacagcatgataaagaactcgacggtgctgcccgaggcaagcagaggcaagccc
agcaaatcaccggttcaccgaaggcagcctggaccgacgattatcatagaggaaaccatc
ggcaatgatttagatgataggagcatatattacaagaaaacaccgctgacgccaaagcaa
tcgtcccacaattcctggcacgaatcgatgccaaatgagaactttgagcaccgcaaggcc
agtgtggatgaatccgtgctaaacgaaacgctggccagccgcaatgtgaatcccttcagt
atggatgtcataaattcactgctggactccattgagttctcgctgtatattgagaagctg
ccgaattgccagctgcaaggacatgtacagcgcctaaagccacagtccacgctcgaggtc
aatggcgacaggtttgaggtcgacaaaatgattggcaagggcgcctatggttccatattt
agcggtattcattgcaagtcgggcaaaaaagtcgccttcaaacaggagaagcccaccaac
tattgggagtattacatctgcctggaggtgcactctcggctggccagtgaggagatgcta
cccgcatatatgcacatcgattatgctctggtgggcaataatagcagcgtttatataatg
gaactttcgacttacggctcgctgatctgtgtgtgcaacaaatacaagaagcacaccacc
aagaatttggatgagtatattgtgatgcatctctgctgtcagctgctcgacattgtcgat
catctgcatgccttgggcatcattcatgccgatattaaagcggataactttctactcacg
agacccttgagtggacaaccaaatgagctcagtgtgcagttgattgactttggtgtggca
attgacaccaaactttttccgcccaatcagacgttcgactatgtgaacaatgaggatgcc
ttcaagtgcattgagatgcgcacccaacgccgctggacgtatcaactggatttatttggt
ctggtgggagtgatgcatgtgctgctctttggcagttacatggaagtgacgcagcgtcag
gcgggcggcgtttggatgccgaagacggcaattcctcgctactttcatcgtcagacatgg
gagtccatattccggacgctgctcaatgtacgcgactgtcgcagcatgccaaatttacag
gaattgcgaacgctgctcaaatctgatctggctgaaaacgagaaatgtgccgaggcggcc
atagccaagttcaatatgattatgaaaagcacaaattag

DBGET integrated database retrieval system