KEGG   Drosophila grimshawi: Dgri_GH21024
Entry
Dgri_GH21024      CDS       T01061                                 

Definition
(RefSeq) GH21024 gene product from transcript GH21024-RA
  KO
K20017  Bcl-2 family protein
Organism
dgr  Drosophila grimshawi
Pathway
dgr04214  Apoptosis - fly
dgr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dgri_GH21024
   04215 Apoptosis - multiple species
    Dgri_GH21024
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6559169
NCBI-ProteinID: XP_001985828
FlyBase: FBgn0128486
UniProt: B4J569
LinkDB
AA seq 298 aa
MPGTSFPTNNDNFCNGFPMATTQAERLLQAQNRRKFSFPATLHSSPLLEVGQRESTRRRL
SNVSDVVTRKLSYSIGWKAAQIPAQDIITQGRCLCGQYIKRRLRRSGLFNKKLGLQRIRS
MLGNSNISMGVVRDVFPAVQVLGDELERMHPRVYNGVARQICRNPGGEFHTPDAVSLLMG
AVGRELFRIEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWGGINTHVLPTTNSLNPLEWTTLVIGVVFGLILLIMLLRFIGNTVIPKIYERFSR
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcccggcacctcattcccaacgaataacgacaatttctgcaacggttttcccatggcg
accacacaagcggaacgactgctccaggcgcagaatcgacgaaagttcagttttccggcc
acactccactcatcgccactgctcgaagtgggccagcgggagtcgacccgccgacggctc
agcaatgtcagcgatgtcgtcacccgcaaattatcctactcgatcggatggaaagcggct
caaatacctgcccaggacataattacacagggacgctgtttatgtggacaatatataaag
cggcgcctgcgacgctcgggactgtttaacaaaaagttgggattgcaacgaattcgcagc
atgttgggcaacagcaatatatctatgggtgttgtgcgagatgtctttccagcggtgcaa
gtgttgggcgacgaactggaacggatgcatccacgtgtctacaatggtgttgcacgacag
atttgccgtaatcctggcggcgagtttcacacgcctgacgctgttagtttgttgatgggt
gctgtgggtcgtgaactgttccggattgagatcacgtggagcaaggtgatctcattgttt
gctatagccggtggcctgtcggtggactgtgtgcgccagggtcatcccgagtatttgcca
aagctaatggagagcgtctccgaagtcattgaggatgaacttgtaccatggatcaatgaa
aatggcggttggggtggcattaatacgcatgtcctgccaacgacaaacagtcttaatcct
ttggagtggacaacgttggtaattggagtcgtctttggtttgattttacttatcatgctt
ttgcgttttattggtaacacagtgattccaaaaatatacgaacgattctcgagatga

DBGET integrated database retrieval system