KEGG   Drosophila grimshawi: Dgri_GH21208
Entry
Dgri_GH21208      CDS       T01061                                 

Definition
(RefSeq) GH21208 gene product from transcript GH21208-RA
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dgr  Drosophila grimshawi
Pathway
dgr04214  Apoptosis - fly
dgr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dgri_GH21208
   04215 Apoptosis - multiple species
    Dgri_GH21208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dgr01002]
    Dgri_GH21208
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Dgri_GH21208
Peptidases and inhibitors [BR:dgr01002]
 Cysteine peptidases
  Family C14: caspase family
   Dgri_GH21208
SSDB
Motif
Pfam: Peptidase_C14 RNase_H_2
Other DBs
NCBI-GeneID: 6559904
NCBI-ProteinID: XP_001986171
FlyBase: FBgn0128670
UniProt: B4J750
LinkDB
AA seq 318 aa
MTDECIIRTFSAVGNGGGHNNNADTIDAKGESSVGSTAAEEGGGAAVVAMNVNKYVARMP
TERNAREYNMNHKKRGIAVIFNHKSFDIPSLSVRNGTNLDCEELRKAFENLEFEVSVHND
CKFRDILKHTEKASEMDHSDNDCIAIAILSHGEHGYLYARDVQYKLDNIWHYFTAQICPS
LAGKPKLFFIQACQGDRFDGGIILEKCVTETDGASSMSYRIPVHADFLFSYSTIPGHYSW
RNPEQGSWYIQSLIKELNANGKKDNILDLLTFVSQRVAIDFESNVPMRPIQDRQKQIPCL
TSMLTRILRFNDKLPTKN
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacggacgaatgcataataagaacctttagcgctgtcggcaacggcggcggccacaac
aacaatgccgataccatcgatgcaaagggagaatccagcgttggctcaacagcagcagaa
gaagggggtggtgcagccgtcgtcgcgatgaacgttaataaatatgtagctcgtatgccc
acggagcgtaacgccagggaatataatatgaatcacaagaagcgcggaatagcagtgatc
ttcaatcacaaatcgttcgatataccatcgctgtcggtgcgcaacggaacgaatttggac
tgtgaggagctgcgcaaggctttcgagaatttggaatttgaagtgtcggtgcataatgat
tgcaaattccgcgatatactcaagcatacggaaaaggcgtcggagatggatcacagcgac
aacgattgcattgcaattgcgatcttatcgcatggcgaacacggctacctctatgccagg
gatgtgcagtacaaactggacaacatttggcactatttcacagcgcaaatatgtccatcg
ctcgccggcaaacccaaattgttcttcatacaagcgtgtcagggcgatcgattcgacggc
ggcataatactggaaaagtgcgtcactgaaacggatggcgcatcctcgatgagctacaga
atacccgtacacgccgactttctattctcatattcaacaattccaggtcactattcgtgg
cgcaaccctgaacagggctcgtggtatatacaatcgctcatcaaagaactgaatgccaat
ggcaaaaaggataatattctagacttgctcacatttgtcagtcagcgtgttgccatcgat
tttgagtcgaacgtgccaatgcggccaattcaagatcgccaaaagcaaattccgtgtctg
acgtcaatgctaacacgtattctgcgctttaacgacaaactaccaacgaaaaattag

DBGET integrated database retrieval system