KEGG   Drosophila grimshawi: Dgri_GH22044
Entry
Dgri_GH22044      CDS       T01061                                 

Definition
(RefSeq) GH22044 gene product from transcript GH22044-RA
  KO
K02885  large subunit ribosomal protein L19e
Organism
dgr  Drosophila grimshawi
Pathway
dgr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dgri_GH22044
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dgr03011]
    Dgri_GH22044
Ribosome [BR:dgr03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Dgri_GH22044
  Archaea
    Dgri_GH22044
SSDB
Motif
Pfam: Ribosomal_L19e HMw1_D2 S6OS1
Other DBs
NCBI-GeneID: 6560162
NCBI-ProteinID: XP_001987662
FlyBase: FBgn0129505
UniProt: B4J9M2
LinkDB
AA seq 204 aa
MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSR
YRVRKNTEARRKGRHCGFGKRKGTANARMPTKLVWMQRQRVLRRLLKKYRDSKKIDRHLY
HDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATK
KQELIALHAREDEIAANAAATAAH
NT seq 615 nt   +upstreamnt  +downstreamnt
atgagttctttaaagctccaaaagaggcttgcagcctccgtcttgcgttgcggcaagaaa
aaagtttggttggatcccaatgaaatcaacgaaatcgccaacacaaactcgcgtcaaaac
atacgcaaactgatcaaggatggtttgatcatcaagaagccggttgtggtgcattcccgc
tatcgtgtgcgcaagaataccgaggcccgtcgcaagggtcgccactgtggctttggcaag
cgcaagggtacagccaatgcccgcatgcccaccaaactggtgtggatgcaacggcagcgt
gtcctgcgtcgcctgctgaagaagtacagggatagcaagaagatcgataggcatttgtat
catgatctgtacatgaagtgcaagggtaatgtgttcaagaacaagcgcgtcctcatggag
tacatccacaagaagaaggccgagaagcagcgcagcaagatgctcgccgatcaggccgag
gccaggcgccagaaggtgcgtgaggcgaggaagcgtcgcgaggagcgcatcgccaccaag
aaacaggagctcatcgcactgcatgccagggaggatgagatcgcagccaacgcggcggcg
acggcggcccattaa

DBGET integrated database retrieval system