KEGG   Drosophila grimshawi: Dgri_GH22247
Entry
Dgri_GH22247      CDS       T01061                                 

Definition
(RefSeq) GH22247 gene product from transcript GH22247-RA
  KO
K20018  cell death protein Grim
Organism
dgr  Drosophila grimshawi
Pathway
dgr04214  Apoptosis - fly
dgr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dgri_GH22247
   04215 Apoptosis - multiple species
    Dgri_GH22247
SSDB
Motif
Pfam: DUF2722 TFIIA Spt20 Presenilin SAGA-Tad1 Kei1
Other DBs
NCBI-GeneID: 6570491
NCBI-ProteinID: XP_001996719
FlyBase: FBgn0129707
UniProt: B4K0B5
LinkDB
AA seq 156 aa
MAIAYFIPDQAQLLARSRQQSAQHAAAADGTNSSSNHRQTESRQQQQQQQQQQQQQQQRT
QFRANISVPLGSEQGAISMSEFGCWELLAQIFCYALRLYSYNPTQRRATVIQISFEISSG
ASDADATAAEGDRETGVGDGDEDGDGDVTDANAKRD
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcaatcgcttactttatacccgatcaggcgcaacttttggccagaagtaggcaacaa
agtgcgcaacatgcagcagctgccgacggcacaaatagctcatccaatcacagacagacc
gagtccaggcaacagcaacaacaacagcagcaacaacaacaacaacagcaacaacgtacg
caatttcgcgccaacatttcggtgccgctgggcagcgagcagggtgccatttccatgtcc
gagtttgggtgctgggagctgttggcgcaaatcttctgctacgccttgagactctacagc
tataatcccacccaacgccgggcgaccgttatacaaatctcattcgagatcagcagcgga
gcaagcgatgcagatgcaactgcagccgagggagacagagagactggagttggagatgga
gatgaagatggagatggagatgtgactgatgcgaatgctaagagagattag

DBGET integrated database retrieval system