KEGG   Drosophila grimshawi: Dgri_GH22974Help
Entry
Dgri_GH22974      CDS       T01061                                 

Definition
(RefSeq) GH22974 gene product from transcript GH22974-RA
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00020  Citrate cycle (TCA cycle)
dgr00190  Oxidative phosphorylation
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
Module
dgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dgr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dgri_GH22974
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dgri_GH22974
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dgri_GH22974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 6568680
NCBI-ProteinID: XP_001995110
FlyBase: FBgn0130431
UniProt: B4JW44
LinkDB All DBs
AA seq 667 aa AA seqDB search
MYKITRVPSILAKNAVNSMQRVATIAASTQSQQRSYHITPGQQQQTKSANPDAISKQYPV
IDHAYDAIVVGAGGSGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEQD
DWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQS
LKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEEGECRGVLAI
NLEDGSLHRFRAQNTVIATGGYGRAFFSCTSAHTCTGDGTALVARQGLPSQDLEFVQFHP
TGIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSRSITIEIMEGRGV
GPDKDHVFLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGIPTNY
RGQVLTIGANGEDKIVPGLYAAGEAACSSVHGANRLGANSLLDLVVFGRACAKTIAEENK
PGAPAPTIKDNAGEFSVANLDKLRHANGQISTADLRLKMQRCMQNHAAVFRDGPILQKGV
AEMKKIYKQFQDVKVIDKSLVWNSDLIETLELQNLLANAQMTIVGAEARKESRGAHARED
FKTRIDEYDYSKPVDGQTKKPVEQHWRKHTLAWVTNEQGDIDLKYRPVIDSTLDQEVETV
PPAIRSY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaattacgcgagtgccatcgattttggccaaaaatgcggtcaactccatgcag
cgtgtggcaacaattgccgcatcgacgcagtcgcagcagcgcagctatcacataacgccc
ggccagcagcagcagacgaaatccgccaatccggatgcgatctccaagcaatatccggtt
atcgatcatgcttacgatgcaatcgttgtcggcgccggcggttcaggattgcgtgctgca
ttcggattggtcgccgaaggctttcgcacggctgtcatcacgaaactattcccaacacgt
tcacatacgatagccgcccagggcggcattaatgcggcactgggtaatatggagcaggac
gattggaaatggcatatgtacgatacggtgaagggtagcgattggctgggcgatcaggat
gccatccattatatgacacgcgaggcgcccaaggccgtcatcgagctggagaactacggc
atgcccttctcccgcacccaggacggcaagatctatcagcgtgcgtttggcggtcagagt
ctgaagtttggcaagggtggacaggcgcacagatgttgtgccgtcgccgatcgcacaggt
cactccctgttgcacaccctctacggtcaatccctcagttacgattgcaattattttgtc
gagtatttcgcgctggatctaatctttgaggagggcgagtgtcgtggcgttttggccatt
aatctggaggatggcagtttgcataggttccgtgcacagaatacggtaattgctaccggt
ggctatggacgcgccttcttctcgtgcacctcggcgcatacgtgcaccggtgatggtact
gctcttgtggcccgtcaaggtctgccctcgcaggatttggaatttgtccagttccatccg
acgggcatttatggagctggctgtctgattaccgagggttgccgtggtgagggcggttat
ctcatcaattcgaagggtgaacgcttcatggaacgctatgcgccagttgccaaggatttg
gcctctcgtgacgtcgtctcacgctcgattactattgagattatggagggtcgtggcgtt
ggacccgataaggatcatgtcttcttgcaactgcatcatttgccacccaaacagctggcg
gaacgtttgcccggcatctccgagacggccatgatctttgccggtgtggatgtgacccgt
gaaccgattcctgtgctgcccacggtccattacaatatgggtggcatacccaccaactat
cgtggccaggtgctcaccatcggtgcgaacggtgaagataaaattgtgcctggtttgtat
gctgccggtgaggctgcctgcagctcggtgcatggtgccaatcgtttgggtgccaattcc
ctgctggatctggttgtctttggacgtgcctgcgcaaaaaccattgccgaggagaacaaa
cccggtgcaccggcgccaacgatcaaggataatgccggcgagttctcggtggccaatttg
gataagttgcgccatgccaatggtcaaataagcacagccgatctgcgcctcaagatgcag
cgttgcatgcagaaccatgccgccgtattccgcgatggacccatcctccaaaagggcgtc
gcagaaatgaaaaagatctacaagcaattccaggacgtcaaagtgatcgacaaatcgctt
gtgtggaactcggatctgattgagacactggagctgcagaatctgctggccaatgcacag
atgaccattgttggcgccgaggcgcgcaaggagtcgcgtggcgcacatgctcgcgaagat
ttcaagacgcgcatcgatgaatatgattacagcaagcccgtggatggccaaacgaagaag
cccgttgagcagcactggcgcaagcataccctagcctgggttaccaacgagcagggtgat
atcgacctcaaatacagacctgtcatcgattcaacgctcgatcaggaggtggaaacggtg
ccgccagcaattcgctcctattaa

DBGET integrated database retrieval system