KEGG   Drosophila grimshawi: Dgri_GH22984
Entry
Dgri_GH22984      CDS       T01061                                 

Definition
(RefSeq) GH22984 gene product from transcript GH22984-RA
Organism
dgr  Drosophila grimshawi
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Eno-Rase_NADH_b
Other DBs
NCBI-GeneID: 6567473
NCBI-ProteinID: XP_001994094
FlyBase: FBgn0130441
UniProt: B4JSU0
LinkDB
AA seq 257 aa
MPNFKDKVIIVTGASSGIGAATAVHLASLGGLLTIVGRNVDKLKETADNILAVGGAAALQ
LQADLDKEEDVERIVAATLQKFGKLDVLVNNAGIIETGTIENTSLAQYDRVMNTNVRSLY
QLTMLASPELIKTKGNIVNVSSACGLRSCPGVLAYNVSKSAVDQFTRCVALELATKGVRV
NSVNPGVIVTELQKRGGLDDAAYAQFLERTKQTHALGRPGDVKEVAAAIAFLASDEASFT
TGVNFPVDGGRHVMCPR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgcccaatttcaaagataaggtgattatcgtgacaggcgccagctcgggcataggtgcg
gccaccgccgtgcacctggccagccttggtggtctgctcacaattgttggacgcaatgtg
gataaactgaaagaaaccgccgacaatattctggctgtaggtggcgctgctgcgctgcaa
ctgcaggcggacctggacaaggaggaggatgtggaacgaattgtggcagctactctgcag
aaatttggcaaactggatgtgctggttaataatgctggcattattgagacgggcaccatt
gaaaatacatcgttggctcaatacgatcgcgtgatgaacaccaatgtgcgttccctctat
cagttgaccatgttggcttccccggagctgatcaagaccaagggcaacattgtcaacgta
tccagtgcgtgtggcctacgctcttgtcccggtgtcctggcctacaatgtgtccaagtcg
gccgttgatcagtttacgcgctgcgtcgccttggagcttgctacgaagggagttcgtgtg
aactctgtgaatcctggcgtcatcgtcacggagctgcagaagcgtggcggtctcgatgac
gctgcctacgcccagtttttggagcgcaccaagcaaacccacgctctgggtcgtcccggc
gatgtgaaggaggtggctgctgcaattgcattcctcgccagcgatgaggcaagcttcacg
acgggcgtcaatttcccagtggacggcggtcgtcatgtcatgtgtccacgttga

DBGET integrated database retrieval system