KEGG   Drosophila grimshawi: Dgri_GH23673Help
Entry
Dgri_GH23673      CDS       T01061                                 

Definition
(RefSeq) GH23673 gene product from transcript GH23673-RA
  KO
K11459  polycomb group RING finger protein 4
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dgr03036]
    Dgri_GH23673
Chromosome and associated proteins [BR:dgr03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     Dgri_GH23673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Retrotrans_gag
Motif
Other DBs
NCBI-GeneID: 6570640
NCBI-ProteinID: XP_001996855
FlyBase: FBgn0131130
UniProt: B4K0Q1
LinkDB All DBs
AA seq 852 aa AA seqDB search
MSTLKCKAHLDDSLLMKPPSAMAPKSIASSKRKSKEPIKAISKKPKLSPPLPREDFKIRL
PAANTTLNTLPPPPAAANADKPLMPPPTAKAPIAVARHKSTPASSNSNSSIASGATQLAA
ATLPFHAPPHHQGMQMAAPGNRTPIAKRYQPILPKASRPNPFANIPSDVNRLLKDAGTEI
KSIASQAKPHVYGPKSQELKMGPPPVPVNKSNSNHNSNSSNSSNNNGSSSKSNNYLNLAL
FNASKSKGKEAPPGCRTPMYTPNSPIYSPSSPQYVPNYNIPTMPTYKYTPKPTTTTTAAT
TTTTAATTGPNNSSSSSSSNYLQNMLNGSNSGLASGLGSLFPTPPTKADQNTNPAVVAAA
AAVSSAGEDAPEKQQVKVKSLLNSCNINIPSSLSITISRDNGDASSPSNAAHAKHKSPVN
NYIEIVKLPDQPAAAATAAAAAATPASVAPPEKEPVKAQPVKLPAPPSKTIPSPQHLLAR
MTPPAQQLPNSSNPPTAVVPPKSSPKMGAGKAVLTPQQSDKKTPSPEKRSAHSPNSGENK
SPKATQSGGATGSGSGSNQTLNGDSAAKKFRPILPRQNAVGGAELAPKLPNVLPLPPANS
NSNNNSSNNNNNNNSSNKKVPASKKSPNPANPKLSLCNGSNAATPTLAKGGAAKKKQPTP
PPATSSCLKMPPPATHPHPHLPNMNAPLGIASATNQLDLSNFLKENLIRAQAAQAAQAAQ
VAAQAANQSNLLYNFGPAMYNYQQAYLMEQLSRMQRAGNEVFNDYLQKLKSVASSSDEHN
NKSVMPMLPTVTLPTAASQAIAGVAAASPKTSPHAAAAKLTPAATPALAKRQPSPRPQAA
ATSNVMSLAKSK
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcttaagtgcaaggcacatctggatgacagtctgctgatgaagccgcccagc
gccatggcgcccaaatcgattgcctcgtcgaagcgcaagagcaaggagcccatcaaggcc
atctccaagaagcccaagctgtcgccaccactgccacgcgaggacttcaagattcggttg
cccgctgccaacacgacgctcaacactctgcccccgccgcccgctgctgcaaacgctgat
aaaccgctgatgccaccgccaaccgccaaggcaccaattgcagtggcacgccacaaatca
accccagccagcagcaacagcaacagcagcattgccagtggagcaacacaattggcagca
gcaacgctacccttccacgcaccgccacaccaccagggcatgcagatggctgcgcccggc
aatcgtacgccgattgccaagcgataccagcccatattgccgaaggcgtcgcgtcccaat
ccctttgccaacatacccagcgatgtcaatcgtctgctgaaggatgccggcaccgaaatc
aagtccattgccagccaggccaagccacatgtgtatgggcccaagagccaggagctcaaa
atgggaccaccaccagtgccagtcaacaaatccaacagcaaccacaacagcaacagctca
aactccagcaacaacaacggcagcagcagcaagtcaaacaactatttaaatttggccttg
ttcaatgcgagcaaatcgaaggggaaggaggcgccaccgggctgccgcacgcccatgtac
acgcccaattcgcccatctattcgcccagctcgccacaatatgtgcccaactataatata
cccaccatgcccacctacaaatacacgcccaagcccacaacgacaacaacagcagcaaca
acaacaaccacagcagcaacaacaggcccaaataacagcagcagcagcagcagcagcaac
tacttgcaaaatatgctaaatggcagcaactctggcctcgcctccggtttgggcagcctt
tttcccacaccgcccaccaaagcggatcagaatacgaatccagctgttgtggctgctgcc
gctgctgtgtcgtctgccggcgaggatgcgcccgagaagcaacaggtgaaggtcaagtcg
ctgctcaactcgtgcaacatcaacataccctcgtcgctgtcgataaccatatcgcgtgac
aatggcgacgcctcctcgccgagcaatgccgcgcacgccaagcacaagagtcccgtcaac
aactacatcgaaattgtcaagttgcccgaccagccagcagcagcagccacagctgcagct
gctgctgcaacgccagccagcgttgcgccgccagagaaggagccggtcaaagcacagcca
gttaagttgccggcgccgccgagcaaaacaataccatcgccacagcatctgttggcgcgg
atgacgccgcccgcacagcagctgcccaactcgagtaatccgcccacggcagtggtgccg
ccgaagagttcacccaaaatgggtgcaggtaaagcagtgctgacaccgcagcagtcggac
aagaagacgcccagtcccgagaagcgtagcgcccattcgcccaattccggtgagaataaa
tcaccgaaagcaacgcagtcaggcggagcaactggctctggctccggctccaaccaaacg
ctcaatggcgactcggctgccaagaaatttcgtccgattttgccacgacagaatgcagtc
ggtggtgctgagctggcgcccaagttgcccaacgttttgcccctgccacctgccaacagc
aacagcaacaacaacagcagcaacaacaacaacaacaacaacagtagtaacaaaaaggtg
cccgccagcaaaaagtcaccgaatccggctaatccgaaactgtcgctttgcaatggcagc
aacgcggccacgcccacgctggccaaggggggcgctgcaaagaagaagcaaccgacgccg
ccgccagcaacaagtagctgtttgaagatgccaccaccagcaacacatccgcatccacat
ttgcccaacatgaatgccccgctgggcattgcctcggcaacgaatcaactggatttgagc
aactttctcaaggagaatctgatacgtgcccaggccgcccaagcggcccaggctgcacag
gttgccgcccaggcggcgaatcaatcgaatctgttgtacaactttggacccgccatgtac
aactatcagcaggcgtatctcatggagcagctgtcgcggatgcagcgcgccggcaacgag
gtgttcaacgattatctgcagaagctgaagagtgtcgccagctccagtgatgagcacaac
aataagtcggtcatgcccatgctgcccaccgtcaccctgccaacggccgccagtcaggca
attgctggcgtggcggcggcgagtccaaagacctcgccacatgccgccgcagctaagctg
acgccagcggcaacgccggccttggccaaaagacagccaagtccccggccacaggcggca
gccaccagcaacgtcatgtccctggccaagagcaagtga

DBGET integrated database retrieval system