KEGG   Dendronephthya gigantea (soft corals): 114521320
Entry
114521320         CDS       T06112                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
dgt  Dendronephthya gigantea (soft corals)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2 Ras_bdg_2 DUF4120 zf-RING_9
Other DBs
NCBI-GeneID: 114521320
NCBI-ProteinID: XP_028397524
LinkDB
Position
Unknown
AA seq 404 aa
MEEDMKMATLKAGEVYNTAALYRSRSVPENISGDHASKQSFNVIKDFLSNIGNWRANKQR
RKLASKRSIAENDSGEFDLHDVKRVKDAHKRLEGGGHVFVAHTDHYITWCDLCGETMWGF
VKRGVRCQRCKYTCHLRCKDEVLLECDGGLIHDAKEMSREEITLKTLEILSQGNVKKNAP
AVLPSDLSPSGLLAMIEEFNKTSLGLIMTLSYNSTNDVIFQGFIRVAMNLLRPINIVAGE
RPLSIFETVSWRREGSSTSSSKRTKTSFFLPPNTMKALHITSDTTAQQVIVALLKKYKIS
DHPRKFALYERYQDDDNVILRRISDEERPLVLRLIWGGSDRSHSFCLQENETGDIMWEAF
SIPELQNFIKILEMEEKEYVKRVLTKYRMYRDQLEEIMAERKGK
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggaagaggatatgaaaatggcgactttgaaagcaggagaggtttataacaccgcggct
ttatatcgatctcgttctgttccagaaaatatttctggcgatcatgcatcaaaacaatct
tttaatgtcatcaaagatttcctatcaaacattggtaactggcgggcgaacaagcagaga
agaaaattagcgagtaaacgaagcatcgctgagaatgatagtggcgaatttgacttgcat
gatgtgaagagagtcaaagatgcacataaacggcttgaaggcggtggtcatgtgtttgta
gcacataccgatcattatataacatggtgtgatttatgtggtgaaacgatgtggggtttt
gtaaagagaggtgttcgttgtcaaagatgtaaatacacttgccatttacggtgcaaagat
gaggtattattagagtgtgacggaggtctcattcatgatgcaaaagagatgagcagagag
gagattacattgaagacccttgaaatactaagtcaggggaatgtgaagaaaaatgcccct
gctgtattacctagtgatttatcacctagtggtttactagcaatgattgaggaatttaac
aagacaagtcttggcctgattatgacactgagctacaactcaacaaacgatgtcattttc
caaggttttatacgtgttgctatgaatcttttacgtccaatcaatattgtcgctggtgaa
agaccactgtcaatttttgaaactgtatcttggaggagagaagggtcttctacttcatca
tcaaagcgaacaaaaacatcatttttccttcctccgaacactatgaaggccttgcacatt
actagtgatacaacagctcaacaggtaattgttgctcttctgaagaaatacaagatttct
gatcatcccaggaaatttgccctttatgaaagataccaagatgatgataatgtgatattg
cgcaggatttctgatgaagaaagaccgttggtgttacgtttaatttggggaggctctgac
agaagtcactcattctgtttacaagaaaatgaaactggggatatcatgtgggaggccttc
tccatacctgaactacaaaactttattaagatcttagaaatggaggaaaaagaatatgtt
aaacgggtattgacgaaatatcgcatgtatcgcgatcagcttgaggaaataatggctgaa
agaaaaggaaagtga

DBGET integrated database retrieval system