KEGG   Dendronephthya gigantea (soft corals): 114526995
Entry
114526995         CDS       T06112                                 

Definition
(RefSeq) fibroblast growth factor 1-like isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
dgt  Dendronephthya gigantea (soft corals)
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dgt04052]
    114526995
   00536 Glycosaminoglycan binding proteins [BR:dgt00536]
    114526995
Cytokines and growth factors [BR:dgt04052]
 Growth factors
  Growth factors (RTK binding)
   114526995
Glycosaminoglycan binding proteins [BR:dgt00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   114526995
SSDB
Motif
Pfam: FGF Fascin MIR
Other DBs
NCBI-GeneID: 114526995
NCBI-ProteinID: XP_028404352
LinkDB
Position
Unknown
AA seq 222 aa
MRKQRFVLCIFGVVLVCLNTFTVVKTSPTNRRISNSLQRRLKRNLTNLAKAFNLSQGFAG
SPRRSKVKKYRLKDRSTALLNGLIDRSLVKAPSTNTRKVMLFSRNGYLLQISNNGFVNGT
HDMSDNVWFELQSVHVGIVRIKNIKTGRYLAMEENNGRLRGHTRLSLKTLFVTHEVKTYH
WYRSYTNSNWYVGIRKNGTQKPAHQTAADQKAVLFFLVPFST
NT seq 669 nt   +upstreamnt  +downstreamnt
atgagaaagcagcgctttgtgttgtgtatatttggagtggttctggtgtgtttgaacaca
tttactgttgttaaaacaagcccaactaaccgccgaatatcaaatagtttacaacgacgt
ttgaaaagaaatcttacaaatctagcgaaggctttcaacttatcacaaggatttgcaggc
agtcctagaaggagtaaagtgaaaaaatatcgtttgaaagacagatcaacagcattgttg
aacggcttaatagaccgatcgttagttaaagccccatcgacgaatactcgcaaggttatg
cttttttcaaggaatggttatctgcttcagatatcaaacaatggattcgtaaacgggacc
catgacatgagtgataacgtttggttcgagcttcagtcagtccatgtgggcatcgttcga
ataaaaaatattaaaacgggtagatatctggctatggaagaaaacaatggtagactccgt
ggtcatactcgtctttcattgaagacgttattcgttacgcatgaggtgaaaacgtatcat
tggtacagatcgtacacaaatagcaattggtatgttggtatacgtaagaacggcacccag
aaaccggcccatcaaaccgcggcggaccagaaagccgtgctttttttcctagtcccattc
agcacataa

DBGET integrated database retrieval system