KEGG   Dendronephthya gigantea (soft corals): 114534410
Entry
114534410         CDS       T06112                                 

Definition
(RefSeq) uncharacterized protein LOC114534410 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
dgt  Dendronephthya gigantea (soft corals)
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dgt04052]
    114534410
   00536 Glycosaminoglycan binding proteins [BR:dgt00536]
    114534410
Cytokines and growth factors [BR:dgt04052]
 Growth factors
  Growth factors (RTK binding)
   114534410
Glycosaminoglycan binding proteins [BR:dgt00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   114534410
SSDB
Motif
Pfam: FGF Fascin SLATT_5 DtxR DUF386 DUF2252
Other DBs
NCBI-GeneID: 114534410
NCBI-ProteinID: XP_028411656
LinkDB
Position
Unknown
AA seq 264 aa
MRGLFLHQDNGTVPFQNVVISLILFFVMYPFAACKSPSSSSANTTGSGNTSLNAQGRQFL
RRINEIINLKERANVLKQCNTTKDKVLAEIMKRYKKILKNMSNKGVKKFRIKDFVREQKI
TGSFAITSTNRRTRQISFKNGQFLHMDNAGVVKGSPVTAGNKNNTIFYVKPTGPQVVMLQ
SSHTKKYVAMDKHGHIHAKTNPDHDALFYSRSEENLFLTLASYKYYLLCPYDMFLAVRNT
GAIKSPHQSVPGQISTQIIFVPVP
NT seq 795 nt   +upstreamnt  +downstreamnt
atgcgtggcctgtttttgcatcaggataatggaactgttccatttcaaaacgttgtcatc
tctttgatactgttctttgtaatgtacccgttcgcggcatgcaagtcgccatccagttcc
agcgccaatacgacaggcagtggtaacacgagtctcaacgcccagggacgtcagttcttg
cgaaggattaacgaaattataaatctcaaggaaagagcgaacgtcttgaagcagtgcaac
acaaccaaggacaaagttctcgcggaaatcatgaaaagatacaagaaaatcttaaagaac
atgtccaacaaaggagtaaagaagtttcgtattaaggatttcgtgagggaacagaaaatc
accggaagctttgcaataacttccacaaaccgacgaacgcgacaaatttcgtttaaaaac
ggacaatttttacacatggataatgctggtgttgtcaagggtagtcctgtgacggctggg
aataaaaataacaccatattctatgtgaagccgacggggccgcaagttgttatgcttcag
tcatctcacacgaagaaatacgttgcaatggacaaacatggccatattcatgccaaaaca
aatccagatcatgatgcactcttttactctcgatcagaggaaaatcttttcctaacactg
gcatcatataaatattatctattatgtccgtacgatatgtttcttgctgtacggaacact
ggtgctataaagtcgccacatcagagtgtaccaggacagatttcaacacagattatattt
gtaccagttccataa

DBGET integrated database retrieval system