KEGG   Dendronephthya gigantea (soft corals): 114536256Help
Entry
114536256         CDS       T06112                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt00040  Pentose and glucuronate interconversions
dgt00051  Fructose and mannose metabolism
dgt01100  Metabolic pathways
Module
dgt_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    114536256
   00051 Fructose and mannose metabolism
    114536256
Enzymes [BR:dgt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     114536256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TmoB HicB-like_2
Motif
Other DBs
NCBI-GeneID: 114536256
NCBI-ProteinID: XP_028413386
LinkDB All DBs
Position
Unknown
AA seq 350 aa AA seqDB search
MAADNLSAVLYKQDDLRLEQREIVKPGKGEVQVAVHSVGICGSDVHYLRKGRIGDFIVKA
PMVLGHETSGTISEVGEGVTSLKVGDRVAVEPGYPCKMCDFCKAGRYNLCPEMTFAATPP
FDGTLCRFYCHPADFCYKLPDSVSFEEGALLEPLSVAVHACRRAGITMGDTVLVCGAGPI
GLVNLLVSKACGASRVAITDLDEKRLEMAKNLGADLTIQVEKGKTAEEIACHIKQLLNEA
PNKIIECTGVESSINAGIFAAKSGGIVVIVGMGKPEVKMPVFNFLAREVDIRGIFRYVNC
YPIALSLVASGAVNVKPLVTHRFKLEESIKAFETTEKGEGIKVVIQCSKE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggacaatctgagtgctgtattgtacaaacaagacgatttgcgtttggaacaa
cgcgagattgtgaaacctggcaagggagaggttcaagttgctgtgcactcagttggaata
tgtggttcagatgtgcactaccttcgcaaaggaaggattggtgacttcattgtaaaagct
ccaatggttcttggccatgaaacaagtggcacaataagtgaagttggggaaggtgtcact
tctctaaaagttggtgatcgtgttgcagttgagccaggatatccctgcaagatgtgtgat
ttttgtaaagctggtcggtacaatctctgccctgaaatgacatttgcagcgacgccacca
ttcgatggtaccttgtgccgtttctactgtcatccggctgatttctgttacaagttacca
gattctgtgagttttgaagaaggagcattactggagccattgtctgttgctgtccacgcg
tgtcgcagggctggtataacaatgggagatactgttctggtttgtggagcaggtcctatt
ggattggtgaatcttcttgtctcaaaggcctgcggagcaagtcgtgttgctataacagac
ttggatgagaaacgtcttgaaatggcgaaaaatcttggtgcagatctcacaattcaagtg
gaaaaaggaaaaactgcggaagagatcgcgtgtcacatcaaacagctgttgaacgaagct
ccaaacaaaatcattgaatgcactggagttgagtccagtattaatgctggtatatttgca
gccaagtcaggtggtatagtggttatagttggaatgggaaagccagaagtcaaaatgcct
gtttttaatttcctcgcgagagaagttgatattcgaggaatattccgctatgttaactgc
tacccaatagcactctctcttgttgcttccggagcggtgaatgtcaaaccattggtgacg
catagatttaaactggaggaaagtataaaagcttttgaaacgacggagaaaggagagggt
atcaaagttgtcatccagtgcagcaaggaatga

DBGET integrated database retrieval system