KEGG   Debaryomyces hansenii: DEHA2A08976gHelp
Entry
DEHA2A08976g      CDS       T01026                                 

Definition
(RefSeq) DEHA2A08976p
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dha  Debaryomyces hansenii
Pathway
dha00250  Alanine, aspartate and glutamate metabolism
dha00410  beta-Alanine metabolism
dha00430  Taurine and hypotaurine metabolism
dha00650  Butanoate metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
Module
dha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DEHA2A08976g
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DEHA2A08976g
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DEHA2A08976g
   00430 Taurine and hypotaurine metabolism
    DEHA2A08976g
Enzymes [BR:dha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DEHA2A08976g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DHDPS
Motif
Other DBs
NCBI-GeneID: 2899700
NCBI-ProteinID: XP_456720
UniProt: Q6BYJ9
LinkDB All DBs
Position
A:complement(747400..748920)
Genome map
AA seq 506 aa AA seqDB search
MTKISCDIESDRVAELDKLLGLIKPKILHYIDKADPNSSNYETDSLGKYHSPEFLKNQFT
DDKQLDSGIKGDYEKLSSTIDQVLKYSVNTWNPGFLDKLYASNNPIGVISDLILSILNTN
SHVYTVSPALSVLENYIGKKYAQLFFDDDQETCGGLTFSGGSWSNITSMQIARALKYPDT
KENGNTNYKFAIYTSEHCHYSVVKGAILLGLGSSNVFKVKILPDGSMDVNNLSEVIERSV
EQGYTPLYINGTAGTTVFGSYDPFEEISKVAKKFDCWFHIDGSWGGNVVFSQTHKSKMKG
SKLADSVTVNPHKMLGIPATCSFLLLPHVSHFQKSMSLSAPYLFHGRESDDDSIENYDLA
DGTMGCGRRADSFKFYMGWLYYGKEGFANRVDHAFAIAKDFVEKISKNPKFKLVIGSEKD
LPACLQVCFYYKPSDYTDHDNTEITRFISRELHKRGRYLVDFSPNPTDKNNEGEFFRVVF
NSPTLTDSVVDDLINSIIEVGAEYKK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaataagctgtgatatagaatcggatagagttgcagaactcgacaaattgtta
ggcttgataaaacccaaaatcttacactacatcgataaggctgatccaaattcttccaac
tacgaaactgactctttgggaaaatatcatagtccggaatttttaaagaaccaatttact
gatgataaacaattagatagcggtattaaaggtgattatgaaaaattatccagtactatt
gatcaggtcttgaaatactcggttaacacatggaatccaggatttttagacaagttatat
gcatcaaacaatccaattggtgttatatcagacttgatactatctattttgaataccaat
tcgcatgtatacactgtttcgcctgctttatcagtattggaaaattatattggtaagaaa
tatgcacaattattttttgacgatgaccaagaaacttgtggaggacttactttttcaggt
ggatcatggtcgaatatcacatcgatgcaaattgcacgagcattgaagtatccagatacc
aaggagaacggtaacaccaattataaatttgccatttatacttcggagcactgtcactac
tcggttgtcaaaggtgctattttgttaggtttggggtccctgaatgtttttaaagttaaa
attttgccagacgggagcatggacgtgaataatttaagcgaggttattgaacgttcggtt
gaacagggatatacacctttgtatataaatggtactgcgggtacaactgtcttcggatca
tatgatccatttgaagagatctccaaggttgccaagaagttcgattgttggttccatatt
gatggatcttggggtggtaacgttgtgttctcacaaacccacaagtccaaaatgaagggt
tcaaagttagctgattccgttacagttaatcctcataaaatgttaggcatcccagctacc
tgctccttccttttgttgccccatgttctgcatttccagaaatccatgtcgttgtcagca
ccatatctattccacggtagggaaagcgacgacgatagtattgaaaattatgatttggct
gacggaactatggggtgcggtagaagagcggattcctttaaattctacatggggtggtta
tactatggaaaagaaggctttgctaaccgtgttgaccatgcatttgccatagctaaagac
tttgttgaaaagatcagtaagaatcctaaatttaaattggttatcggcagtgaaaaagat
ttacccgcatgcttgcaagtctgcttttattataagccatctgattatacagaccacgac
aataccgaaatcactcgtttcatctccagggaattacataaaagaggtagatatttggta
gacttttctcctaaccctaccgataaaaacaatgaaggtgaattttttagagttgtattc
aattctcctactttgaccgatagtgttgtcgatgatttaatcaacagcattattgaagtt
ggtgcggaatacaaaaaatag

DBGET integrated database retrieval system