KEGG   Debaryomyces hansenii: DEHA2D03190gHelp
Entry
DEHA2D03190g      CDS       T01026                                 

Definition
(RefSeq) DEHA2D03190p
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dha  Debaryomyces hansenii
Pathway
dha00052  Galactose metabolism
dha00500  Starch and sucrose metabolism
dha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DEHA2D03190g
   00500 Starch and sucrose metabolism
    DEHA2D03190g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     DEHA2D03190g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 2900858
NCBI-ProteinID: XP_458606
UniProt: Q6BT64
LinkDB All DBs
Position
D:complement(271863..274718)
Genome map
AA seq 951 aa AA seqDB search
MHLSTFVNFIGLGLISTVCGSPIATESNSNKASSTFDESSRATISDEMTWGVAQTPNILN
DTAVDANAVAKGYDLVNVSQTAHGLAGILKLNEATNIYGYDFDCLNLLVEYQADSRLHVH
IEPANLTDVFVLPEDLIAKPRIESNNVTFDTSDLVFKYQEKNFGFSVIRSSTGEVLFSTI
GNPLVYSNQFIQFNTTLPKDHVVTGLGESIHGSINEPGVVKTLFANDVGDPIDGNIYGVH
PVYMDHRYDSNTAHSVYWRTSAIQEVVVEEEALTWRALSGVVDLYFFSGPEPKDVIKQYV
HEIGLPALQPYWALGYHQCRWGYDTIEELEEVVSNFKKFDIPLETIWSDIDYMDGYKDFT
TDPHRYPLDKFKKFIDDIHGTDQHYIPMFDAGIYVPNPNNASDIYEIFHNGNESDSFLKN
PDGSLYIGSVWPGFTAFPDFLAPKSQEFWTKTIKDFYDKVQFDGLWCDMNEASSFCVGSC
GSEGYLQNPAKPNFEYGDVSDTYPKGFEQSNASEYSSIQQKASSTSSAASSSTSISDSQN
TIAPGKGNINYPPYAINHAQGDHDLATHAISPNATHYDGTIEYDVHNLYGYMEVNATYNA
LLEAIPNKRPFILSRATFAGSGKHAAHWGGDNTADWAWMYFSIPQALSMGMSGIPFFGVD
VCGFNSNTDSELCSRWMQLGSFFPFYRNHNTLGAISQEPYVWSSVTDATKITMNIRYLLL
PYYYSLLHESHESGLPVLRALSWEFPNQRNLSTVDTQFFVGDALLVTPVLEPSVETVKGV
FPGSGITEIYYDWYTHEQVDFQAGKNETLEAPLGHIPLHIRGGNILPTQEPGYTIAQSRK
NPFGLIVALDKNGGASGKLYLDDGESQEVESSLFVNFVALNNTIVSSPYGDYKISEPLSN
ITILGVNEKPDSVTFEGKDVTYTYENSTLFVTDLNKDSKDGAFDKQFTLKW
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgcatttactgacttttgttaattttataggcttggggctcatctccactgtatgtggg
agtcctattgctacagaatctaacctgaataaggcttcgtcaacttttgatgaatcctct
agagctactattctggatgaaatgacttggggtgttgcacagacaccaaatattttaaat
gacactgcagtggatgctaatgcagttgcaaagggttatgatttggtcaatgtttcccaa
actgctcatggtctcgcgggtattctaaagttgaatgaagctactaatatatacgggtac
gactttgattgcttgaacttgttggttgaatatcaagcagattctcgtttacatgttcat
attgagccggccaatttgacagatgtttttgttttgccagaggatcttattgcaaaacct
cgcattgaatctaacaatgtcacttttgatacatctgatttggtatttaaataccaagag
aagaactttggtttctcagtgatcaggtcttccaccggtgaggttttattctctacaatt
ggtaatccattagtgtactctaatcaatttattcaattcaacacaacgttacctaaggac
catgtcgttactggccttggtgagtcgattcatggatcaataaatgagccaggtgttgtt
aagaccttgttcgccaatgatgttggagacccaattgacggtaatatatatggtgttcat
ccagtgtatatggatcatagatatgattcaaatacggcacatagtgtatattggagaact
tcagcaattcaggaagtcgttgttgaagaggaggcattaacatggagagccttgagtgga
gttgttgatttatatttctttagcggtccagaaccgaaagacgttataaagcaatatgtt
cacgaaatcggtttgccagcacttcaaccatactgggcacttgggtaccatcagtgtagg
tggggctatgatactattgaagaattagaagaggttgtttcaaacttcaaaaaatttgat
attccgttagaaacaatctggtccgatattgattatatggatggatataaagattttacc
actgatcctcatagatacccattagataaatttaagaagttcattgatgatatacatgga
actgatcaacattatattccaatgtttgatgccggaatctatgttccaaatccaaataat
gccagtgacatttatgaaatatttcataatggtaacgaatcagattcattcttgaaaaat
cctgatggctcattatacataggttctgtttggccaggcttcactgcctttccagatttc
ttggctccaaaaagtcaagaattctggaccaagacaataaaagacttttacgataaggtt
caatttgatggcctctggtgtgacatgaatgaggcttccagtttctgcgtaggttcttgt
ggttcagagggttaccttcagaatcctgcgaaacctaattttgaatatggtgatgtttct
gatacttatccaaaaggatttgagcaaagtaatgcgtctgaatattcatccattcaacaa
aaagcttcttcgacatcttcagctgcttcgtcttctacttccatttcagattctcaaaat
actatcgctcccggtaaaggtaatattaactatccaccatatgcaatcaaccatgcgcaa
ggtgaccatgatttagcaacgcatgcaatttctcctaacgcaactcattatgatggtacg
attgaatatgatgtgcataacttatacggttatatggaagtgaatgctacttataatgcg
ttattagaagctattcctaataagagaccattcatcctttctagggccacttttgcaggt
tcagggaaacatgctgctcattggggaggtgataacacagctgattgggcctggatgtac
ttctcaattccacaagctttgagtatgggaatgtctggtattccattttttggtgttgat
gtttgtggtttcaatagtaacactgattctgagttatgttctaggtggatgcaactaggg
tcattctttcctttctacagaaaccacaatactttaggtgctatatctcaggagccttat
gtctggtcaagtgttaccgacgcgacaaagattaccatgaatatccgttacttattattg
ccatactactatagtttgcttcatgaatcacatgaaagtggcttaccagttttgcgtgca
ttatcctgggaatttccaaatcagcgtaacttaagtactgttgatactcaattctttgtt
ggtgatgccttgttagttacccctgttttagaaccaagtgttgagactgttaaaggtgtt
ttccctggtagtggaataacagaaatttactacgactggtacactcatgaacaagtggat
ttccaggcaggtaaaaatgaaacattagaagccccattaggacatataccattacatatt
agaggtggtaatatcctaccaacccaagaaccaggatatacgattgcacaaagtagaaaa
aatcccttcgggttgattgttgctttagataaaaatggtggtgctagtggaaaattgtat
cttgacgatggtgagtctcaagaagttgaatcttctttattcgttaactttgtggcttta
aacaatactatagtatcttcgccatatggtgattataagatatccgaaccattgtctaat
atcactattcttggagtaaacgaaaagcccgattcggtcacttttgagggtaaagatgta
acgtacacctatgaaaactcaacattatttgttaccgatttgaataaagatagcaaggat
ggtgcgtttgacaaacagttcactcttaaatggtaa

DBGET integrated database retrieval system