KEGG   Debaryomyces hansenii: DEHA2E06556gHelp
Entry
DEHA2E06556g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E06556p
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00051  Fructose and mannose metabolism
dha00052  Galactose metabolism
dha00500  Starch and sucrose metabolism
dha00520  Amino sugar and nucleotide sugar metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
Module
dha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2E06556g
   00051 Fructose and mannose metabolism
    DEHA2E06556g
   00052 Galactose metabolism
    DEHA2E06556g
   00500 Starch and sucrose metabolism
    DEHA2E06556g
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2E06556g
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DEHA2E06556g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dha04131]
    DEHA2E06556g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     DEHA2E06556g
Membrane trafficking [BR:dha04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    DEHA2E06556g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2
Motif
Other DBs
NCBI-GeneID: 2901882
NCBI-ProteinID: XP_459592
UniProt: Q6BQC8
LinkDB All DBs
Position
E:complement(524381..525802)
Genome map
AA seq 473 aa AA seqDB search
MLNLKLQTAVDDIVNQFTVTEEFLHDATKEFTKSMDTGLQNTASKREYMPMIPTYVTGIP
TGKEKGLFLAADLGGTNFRVCSVNLHGDHTHELKQSKYSIPLDLMKNSTADSLFSFLAKK
VETFLKDNHDDLEADEQLKLGFTFSFPINQTALNRGTLIRWTKGFDLPDCVDKDVVELLQ
SNIDLLGCKVNVVALANDTVGTLLSRAYSNNPEKTNANTIVGAIFGTGTNGAYFETLDNI
PKLKSTNIPEGAKGMVINTEWGSFDNTLKILPKTKYDEIVDSETANKGFHLFEKRISGMF
MGEILRVCLIDLFQRDLIFVDLYKSRGGSLPHRLSEEWLLSSEVLSYLQIDDSTDLKMSE
LILENELRLPTTKEERIVIQKLTQAIAHRAAYLSAIPVAAILNRVKGQFSNDNRDFEFGC
DGSVVEFYPGFQASILEALEIINPLEGEKKKVHLKIAKDGSGVGAALCASTAK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacttaaaattacagacagcagttgacgatatcgtgaaccaattcaccgttact
gaagaatttcttcacgatgcgactaaggaatttactaaatcaatggacactggtttacaa
aacactgcgtcgaaaagagaatacatgccaatgatcccaacgtatgtcactggtattcct
actggtaaggaaaaaggcttatttttagcagcagatttaggtggtactaattttagagtc
tgttctgtcaatcttcatggagaccacactcatgaattaaagcaatcaaaatacagtatc
ccattggatttgatgaagaactctactgccgatagtttattctctttcttagccaaaaag
gttgaaacatttttgaaggataatcatgatgacctagaagcagatgagcaattaaaatta
ggctttactttctctttccctatcaaccagactgctttaaataggggcactttaattcgt
tggacaaagggattcgatttaccagattgtgttgacaaggacgttgttgagttattacaa
tccaacattgacttgttaggatgtaaagtcaatgtggtagcattagccaatgatactgtt
ggtacattattatcaagagcctattccaataaccctgagaaaactaacgctaacactatt
gtgggtgctatttttggtactggtactaatggagcatattttgaaacccttgataatatt
cctaaattaaaatctactaatattccagaaggtgccaaaggtatggtaattaatactgaa
tggggttcgttcgataacactctaaaaatattaccaaaaactaaatatgatgaaattgtc
gattcagaaactgctaataaaggctttcatttatttgaaaaaagaattagtggaatgttt
atgggagaaattttacgtgtttgtttgattgatttatttcaacgtgaccttatctttgtt
gatttatataaatctagaggtggttcattacctcacagattatctgaagaatggttatta
tcttctgaggttttatcttacttgcagattgatgattcaactgacttaaaaatgtctgaa
ttaatattagagaacgaattaagattgcctactactaaagaagaaaggatagttattcag
aaattgactcaagctattgcgcatagagctgcttatctttcggctattcctgttgctgct
atactcaatcgtgtcaagggacaattctccaacgataatagggactttgaattcggttgt
gacggatctgttgtagaattttatccgggattccaggcttctattttagaagcattagaa
ataatcaatcctttagagggagaaaagaaaaaggtccacttaaaaattgccaaagatggc
agtggagttggagctgcgttatgtgccagcacagcaaaataa

DBGET integrated database retrieval system