KEGG   Debaryomyces hansenii: DEHA2E07458gHelp
Entry
DEHA2E07458g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E07458p
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00020  Citrate cycle (TCA cycle)
dha00190  Oxidative phosphorylation
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
Module
dha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dha_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEHA2E07458g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DEHA2E07458g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DEHA2E07458g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 2902446
NCBI-ProteinID: XP_459635
UniProt: Q6BQ85
LinkDB All DBs
Position
E:complement(590883..592814)
Genome map
AA seq 643 aa AA seqDB search
MLSLRRSALAATKFSNNKRFFTSSCVKLQTIGDNIKGNDLNTAKYMGKQYHVIDHEYDCV
VVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYD
TVKGSDWLGDQDAIHYMTREAPDSIYELENYGVPFSRNDEGRIYQRAFGGQSKEFGKGGQ
AYRTCAVADRTGHALLHSLYGQALRHNTHFFIEFMAMDLLMQDGECVGVMAYNQEDGTLH
RFRSHKTIMATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDMEFIQFHPSGIYGSGC
LITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEINEGRGVGPEKDHMH
LQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPVLPTVHYNMGGIPTKYNGEVITKG
PNGEDKVVPGLLACGEVACASVHGANRLGANSLLDLVVFGRAVSHTIRDSLTPGTPLPPL
AADSGKESIENLDKLRTADGSKSTAQIRLEMQKTMQKGCAVFRTQETLDECIEHIGQVDK
TFSDVGTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARKESRGAHAREDYPDRDDVN
WWKHTLSYQTNFGDDVKLDYRDVIQTTLDESECKPVPPTVRAY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcttacgccgttcagctttagctgctactaagttttcaaataataaacgtttt
ttcacatcttcatgtgtcaagctacaaactattggggacaacattaaaggtaatgatctc
aacactgctaagtatatgggaaagcaataccatgttattgaccacgaatacgactgtgtc
gttgttggtgctggtggtgctgggttaagagcagcatttgggttggccgaggccgggttc
aagacagcttgtatttcgaaattgtttcctaccagatcccacactgtggcagcacaaggt
ggtattaacgcagcattaggtaacatgcacaaggatgactggcactggcacatgtacgat
actgtgaagggttcagattggttaggagatcaagatgctattcactacatgaccagagaa
gcaccagactcgatttacgaattggaaaactacggtgtgccattctcgagaaatgacgaa
ggtagaatttaccaaagagcgtttggtggtcaatcgaaggaattcggtaaggggggacaa
gcttacagaacttgtgctgttgctgatagaactggacatgcgttattgcactctttatac
ggtcaagctttgagacacaacacccatttctttattgaattcatggccatggacttgtta
atgcaagatggtgaatgtgtaggtgtaatggcttacaaccaagaagatggtacattacac
agattcagatcgcacaagaccattatggctaccggtggttacggaagagcttatttctcg
tgtacttctgctcacacatgtactggtgatggttacgccatggtttccagagctggttta
ccattagaagatatggaattcattcaattccatccatccggtatttacggttccggttgt
ttgattactgaaggtgctagaggtgaaggtggtttcttagtcaactctgaaggtgaaaga
tttatggaacgttacgccccaactgctaaggatttagcttgtagagatgttgtttcccgt
gctatcactatggaaattaacgaaggtagaggtgttggtccagaaaaggatcacatgcac
ttgcaattatcccacttaccaccatctgtcttgaaggaaagattaccaggtatttctgaa
actgctcacatttttgccggtgtcgatgtcaccaaggaaccaattccagttttaccaacc
gtccattacaatatgggtggtattccaactaagtacaacggtgaagtcataaccaagggt
ccaaatggtgaagataaggtcgttccaggcttattagcctgtggtgaagttgcctgtgct
tctgtccacggtgctaacagattaggtgccaactccttattagatttagttgtcttcggt
agagctgtttctcacactatcagagactctttgactccaggtactccattgcctccatta
gctgctgacagcggtaaggaatcaattgaaaacttggacaagttaagaaccgctgatggt
tccaaatctactgctcaaattagattggaaatgcaaaagactatgcaaaagggttgtgcc
gttttcagaactcaagaaaccttggacgaatgtattgaacatatcggtcaagtcgataag
actttctccgatgttggtaccaccgacagatccatgatttggaactccgacttggttgaa
accttagaattacaaaacttgttaacctgtgccacccaaaccgccgcctctgctgctgcc
agaaaggaatctagaggtgcccatgccagagaagattacccagacagagacgatgttaac
tggtggaagcacactttgtcctaccaaactaacttcggtgacgatgttaaattagactac
agagatgtcattcaaactactttagacgaaagcgaatgtaagcctgttccaccaactgtc
cgtgcttactag

DBGET integrated database retrieval system