KEGG   Debaryomyces hansenii: DEHA2E10692gHelp
Entry
DEHA2E10692g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E10692p
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dha  Debaryomyces hansenii
Pathway
dha00020  Citrate cycle (TCA cycle)
dha00480  Glutathione metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
dha01210  2-Oxocarboxylic acid metabolism
dha01230  Biosynthesis of amino acids
dha04146  Peroxisome
Module
dha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dha_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEHA2E10692g
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DEHA2E10692g
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DEHA2E10692g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DEHA2E10692g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 2902959
NCBI-ProteinID: XP_459772
UniProt: Q6BPU8
LinkDB All DBs
Position
E:836532..837845
Genome map
AA seq 437 aa AA seqDB search
MFRNGVMRNPAMSGYSKYSMRSFSSSLINLDKIKVKNPIVELDGDEMTRIIWQRIKDKLI
NPYLDVDLKYYDLGIESRDKTDDQITIDAANAIKEYGVGVKCATITPDESRVEEFNLKKM
WLSPNGTIRNILGGTVFREAIIIPRIPRLVPGWKEPIVIGRHAHGDQYKATDLVINEPGK
LEMTFTPENGGAPETRTVYDYKGPGVGLAMYNTDESIIGFAHSSFKMALTKKLPLYLSTK
NTILKKYDGRFKDIFHEIYESTYKKEFETNNIWYEHRLIDDMVAQMIKSKGGFVMALKNY
DGDVQSDIVAQGFGSLGLMTSVLMTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIAS
IFAWTRGIAQRGRLDDTPDVVKFAEIVEKATFDTVQEDGIMTKDLALALGRTDRESYVTT
TEFLDAVSDKLQKQVQV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaatggagtcatgagaaacccagctatgtctgggtacagcaaatattcaatg
cgttcattttcgtcgagtttaatcaacttggacaaaattaaagtgaaaaatccgattgtc
gaattagatggtgatgaaatgaccagaatcatctggcaaagaatcaaggacaaattaatt
aacccatacttggatgttgatttgaaatattacgatttaggtattgaaagtagagataaa
acagacgatcagatcaccattgatgcggccaacgccattaaggaatacggggttggtgtc
aagtgtgctacgatcacacctgatgaatccagagttgaagaatttaacttgaagaagatg
tggttgtcgccaaatggtaccattagaaatattttaggaggtaccgttttcagggaagcc
attattattcctagaattccaagattggtaccaggatggaaggaacctattgtcattggt
agacatgcacatggtgaccaatataaggctactgacttggtcattaacgaaccgggtaaa
ttggaaatgacttttaccccagaaaacggtggagctccagaaactagaactgtgtacgat
tacaagggacctggtgtcggtttagctatgtataataccgatgagtccatcattggtttt
gcccattcttccttcaagatggcattaactaagaaattaccattatacttgtcaaccaaa
aacactattttgaagaaatacgatggaagattcaaagacattttccatgaaatttatgaa
tccacctacaaaaaagaatttgaaaccaataacatctggtacgaacatagattaattgat
gatatggttgcacaaatgattaaatctaagggtggttttgtcatggccttgaagaactat
gatggtgatgtgcaatctgatattgttgcccaaggatttggttcattgggtttaatgact
tctgttttgatgaccccagatggtaagaccttcgaaagtgaagctgcacacggtactgtc
acaagacatttcagacaacatcaacaaggtaaggaaacttcaaccaactcgattgcctcc
atttttgcctggactagaggtattgctcaaagaggtagattagatgacaccccagatgtc
gtaaaattcgccgaaattgtggaaaaggctacctttgatactgttcaagaagatggtatt
atgactaaggatttggctttagctcttggcagaaccgatagagaatcctacgtaaccaca
actgaatttttggatgcagtttctgacaagttacagaaacaagtccaagtttag

DBGET integrated database retrieval system