KEGG   Debaryomyces hansenii: DEHA2F10450gHelp
Entry
DEHA2F10450g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F10450p
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dha  Debaryomyces hansenii
Pathway
dha00250  Alanine, aspartate and glutamate metabolism
dha00410  beta-Alanine metabolism
dha00430  Taurine and hypotaurine metabolism
dha00650  Butanoate metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
Module
dha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DEHA2F10450g
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DEHA2F10450g
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DEHA2F10450g
   00430 Taurine and hypotaurine metabolism
    DEHA2F10450g
Enzymes [BR:dha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DEHA2F10450g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 8998936
NCBI-ProteinID: XP_002770790
UniProt: B5RUD7
LinkDB All DBs
Position
F:complement(898315..900024)
Genome map
AA seq 569 aa AA seqDB search
MTLSKHINAEDLESKLLKQTKKTVLDNHEEYIFKYSANATVPKYEIPEKSSNSELVYKYI
SEELSLDGIPTLNLASFVNTNIDDIPLRLASENITKNLADNDEYPSLIDIQGRCVTILSN
LWNAPSTTDKESGKKVINSIGSATTGSSEAIMMAGLAMKKSWQARQKANGKSIAEPNILM
ASCAQVALEKFARYFDVENRIIHINEKSGHLIDTTKIKENIDENTIGIFVILGSTFTGAF
EPVEEISKLLDEVEKERGIDVKIHVDGASGGFVAPFVYPHLKWDFSIDRVISINTSGHKF
GLTSAGLGWIIWKDNKYLPDDVRFKLDYLGGVEETFTFNFSRPGFPVLFQYYNFLTLGRE
GYTKIFNSCIQNARLLSNFLEESGYFECLSVIHKGIDKERQAKIFTREHNDSSKHSKKAV
VNEEYEPGLPVVAFRFSKEIREKYPDIPQSILSLLLRNKGYIIPNYKLSPDEQDIEILRV
VVRDTLGLNLLDKLMNEIVSTIELLINATDTITNLSTKEQSSEKNEMIYSMLLSIASNGG
EDLKEIKQQILKDNNEQHRKHAKSYRGTC
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcgaaacacataaacgctgaagatttggaatccaagttattaaaacagacc
aaaaagacagtcttagataaccacgaggagtatatatttaaatatagcgcaaatgctaca
gtaccaaaatatgaaattcctgaaaaaagttccaatagcgaattagtgtataaatacatc
agtgaggaattgtctttggacgggattcctacattgaatttagcttcgttcgtgaatacg
aatattgatgacattccattgagattggcttctgagaatattacgaagaacttggcggat
aatgatgaatatccgtcattgatcgacattcaaggtagatgtgttacgattttgagtaac
ttgtggaatgccccaagtacaactgacaaggaatcaggtaagaaggtaatcaattccatt
ggtagtgctactacaggttcgtctgaagccattatgatggctgggttggcaatgaagaaa
tcttggcaagctaggcaaaaggcaaatggtaagtctattgcagaaccaaatattcttatg
gcttcgtgtgcacaagttgcattagagaaatttgcccgctactttgatgtcgaaaataga
ataatccatatcaatgaaaaatcgggtcacttaattgacacaaccaaaattaaggaaaat
attgatgagaatactataggtatttttgtaattttaggttcaacatttactggtgcattt
gagcctgttgaagaaatttccaagcttttagatgaagttgaaaaagaaagaggaattgat
gtcaagattcatgttgatggtgctagtggtggttttgttgctccttttgtttatcctcat
ttgaaatgggatttttcgatcgatagggtcatttccatcaacacatcgggacataaattt
ggcttaacttcggctggtttaggatggattatttggaaggacaacaagtacttgcctgat
gatgtcagatttaaattagattacttaggtggagttgaagagacatttactttcaacttc
tcaagacctgggttccctgtattatttcaatattataatttcttgactttaggtagagag
ggatacaccaaaattttcaattcatgtattcagaatgcaagattattatccaatttcttg
gaagaatcaggttacttcgaatgtctttcagttattcataagggaattgataaagaaaga
caagcaaagatcttcacaagggaacacaatgatagttccaaacattccaaaaaggcagta
gtaaatgaggaatatgaacctggcttacctgttgttgcctttagattctcgaaggaaatc
cgagaaaagtatccggacattccccaatcgattctttctttgttgttaagaaataagggg
tacattattccaaattataaattaagtccagatgaacaagatatcgagatattgagagtt
gttgttcgtgatacgttgggattaaacttgctagacaagttgatgaacgaaattgtttcg
actatcgaattattaattaatgctactgatactattacgaatctttctaccaaagaacaa
tcttcagagaagaacgagatgatttacagcatgttattgtcaatcgcttctaatgggggt
gaagatcttaaggaaattaaacaacagattttgaaagataacaatgaacaacaccgtaag
catgccaaatcttaccgtggtacatgctaa

DBGET integrated database retrieval system