KEGG   Debaryomyces hansenii: DEHA2F13992gHelp
Entry
DEHA2F13992g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F13992p
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00051  Fructose and mannose metabolism
dha00052  Galactose metabolism
dha00500  Starch and sucrose metabolism
dha00520  Amino sugar and nucleotide sugar metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
Module
dha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2F13992g
   00051 Fructose and mannose metabolism
    DEHA2F13992g
   00052 Galactose metabolism
    DEHA2F13992g
   00500 Starch and sucrose metabolism
    DEHA2F13992g
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2F13992g
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DEHA2F13992g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     DEHA2F13992g
Membrane trafficking [BR:dha04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    DEHA2F13992g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 YcgL
Motif
Other DBs
NCBI-GeneID: 2904079
NCBI-ProteinID: XP_460972
UniProt: Q6BLE9
LinkDB All DBs
Position
F:complement(1188800..1190248)
Genome map
AA seq 482 aa AA seqDB search
MVHLGPKPPQHRKGTFTDVPEDLMKELNELEELLTVSPDTLKKITEHFIGELEKGLSKQG
GNIPMIPGWVLDFPTGKEKGDYLAIDLGGTNLRVVLVKLGGNRDFDTTQSKFALPETMRT
ATSDELWTFIAECLKKFVQEEFPQGCTKPLPLGFTFSYPASQKSINTGVLQRWTKGWDID
GVEGHDVVPMLQKAIEKVGVPINVVALINDTTGTLVASMYTDAETRMGLIYGTGCNGAYY
DVVSDIPKLEGKMPSDVDQSAPMAINCEYGAFDNELVVLPRTKYDILIDKQSPRPGQQSY
EKMISGYYLGEVLRLILLDLAKEKKLIFKGQDLSKLETEFILDTSFPSRIEEDPFENLSD
TAELFQKELGIQTTSPERKIIRRLAELIGERSARLFVCGIAAICKKRGYKTAHCAADGSV
YNKYPGVKERTAKALRDIFEWETKEDLITIVHAEDGSGVGAAVIAALTEKRLEQGLSVGI
QD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacttaggtccaaaacctccacagcacagaaagggtacttttaccgatgttcct
gaagatctcatgaaggagttgaatgagttagaagaattattgactgtttctccagacacc
ttaaaaaaaatcactgaacacttcattggtgaattggaaaaggggttatccaagcaagga
ggtaacattcctatgatcccaggatgggttttagatttcccaactggtaaggaaaaggga
gactatttggctattgatttaggtggaactaacttaagagttgtgttagttaagttaggt
ggtaacagagatttcgataccactcaatctaagttcgcattaccagaaaccatgagaact
gctacttctgatgaattgtggactttcattgctgaatgtttgaagaagttcgttcaagaa
gaattcccacaagggtgcactaaacctttaccgttaggtttcactttctcttacccagca
agtcaaaagtctatcaacactggtgttttacaaagatggactaaaggttgggatatcgat
ggtgttgaaggccacgacgttgttccaatgttacaaaaggctatcgagaaggttggagtc
ccaatcaatgttgttgctttgattaacgataccactggtactttagttgcttccatgtac
accgatgctgagactagaatgggtttgatctatggtactggttgtaatggtgcctactat
gatgttgttagtgatattccaaagttggaaggcaagatgccaagcgatgttgaccaaagt
gccccaatggcaatcaactgtgaatatggtgcatttgacaatgaactcgtcgtgttacca
agaacgaagtatgatattctcatcgacaaacaatctccaagaccaggccaacaatcttat
gaaaagatgatttccggttactacttaggtgaagtcttgagattgattttacttgattta
gccaaggaaaagaaattgatcttcaagggtcaagatttatctaagttagaaaccgaattt
atcttagatacctcattcccttctaggatcgaagaagatccatttgaaaacttaagcgac
actgccgaattattccaaaaagaattaggtattcaaaccacttcgccagaaagaaagatc
attcgtcgtcttgctgaattaatcggtgaaagatctgctagattatttgtctgtggtatt
gccgcaatttgtaagaagagaggttacaagactgcccattgtgctgctgacggttccgtt
tacaacaaataccctggtgtcaaggaaagaactgctaaggccttaagagatatttttgaa
tgggaaactaaagaagaccttatcactattgtccacgccgaagatggttccggtgttggt
gctgcagtcatcgctgccttaaccgaaaagagattggaacaaggcttatctgttggtatt
caagattaa

DBGET integrated database retrieval system