KEGG   Debaryomyces hansenii: DEHA2F17798gHelp
Entry
DEHA2F17798g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F17798p
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
dha  Debaryomyces hansenii
Pathway
dha00020  Citrate cycle (TCA cycle)
dha00310  Lysine degradation
dha00380  Tryptophan metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
Module
dha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEHA2F17798g
  09105 Amino acid metabolism
   00310 Lysine degradation
    DEHA2F17798g
   00380 Tryptophan metabolism
    DEHA2F17798g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     DEHA2F17798g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 2904294
NCBI-ProteinID: XP_461134
UniProt: Q6BKY7
LinkDB All DBs
Position
F:1502234..1505227
Genome map
AA seq 997 aa AA seqDB search
MLRAFRSAIPRAQLMKAQVKPFVRLFATGQDSFLLSNNANYIDEMYAAWKHDPSSVHISW
NAYFKNIESSNVPPSKAFTAPPTIIPTVAGGAAGFVPGSSPTNEDVVTHLKVQLLVRAYQ
VRGHQKAKIDPLGISFGDNDVVPKELTLEHYGFTEADMDKQITLGPGILPRFAEGGKKSL
TLREIISNCERLYCQSYGVEYIHIPSKEQCDWLRERIEIPEPYKYSPDEKRQILDRVIWS
CSFESFLASKFPNDKRFGLEGAESVVPGMKAMIDTSVEFGVEDIVIGMPHRGRLNMLSNV
VRKPNESIFSEFTGSREFDEGSGDVKYHLGMNYARPTTSGKHVNLSLVANPSHLESEDGV
VLGKTRAIQQYKNDIGEYKKAMSILLHGDAAFSGQGVVYETMGLANLPDYSTGGTIHIIV
NNQIGFTTDPRFARSTLYPSDIAKSINAPIFHVNADDVEANIFIFNLAAEWRATFHTDVI
IDLVGYRKHGHNETDQPAFTQPLMYQKIAEKKPVIDYYTKQLIEEGTFTKEDIDEHKKWV
WNILDESFSKSKEYQSTSREWLTTAWEDFKSPKELATEVLPHLPTAVEEDTLKKIGTAIS
EAPEGFEVHRNLKRILNARKKSVETGEGIDWSTGEALAYGSLALEGYHVRVSGQDVERGT
FSQRHAVLHDQSSEQTYTPLNNLSEDQGAFVICNSSLSEYGVMSFEYGYSLTSPDALVQW
EAQFGDFANTAQVIVDQFISAAESKWKQRSGLVLSLPHGYDGQGPEHSSGRIERYLQLCN
EDQRYFPSPELLERQHQDANMQVAYPTTPANIFHLLRRQMHRQFRKPLVLFFSKQLLRHP
LAKSELSEFTGESHFQWIIEDPELGKSINAKEDIKRVILCSGQVFTALHKKRADIEDKST
AFIKIEQLHPFPFAQLRDALDSYPALEDLVWCQEEPLNMGSYSYSAPRIATVLENTEKHK
DKSLRYAGRDPSASVAAGTKAMHNSEEEEFLKEVFQN
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgcttagggcttttagaagcgcaattcctcgcgctcaattaatgaaagctcaagtaaaa
ccatttgttcgtttatttgctaccggtcaagactcgtttttattgagcaacaatgccaac
tatattgatgaaatgtatgctgcttggaaacatgatccatccagtgttcatatttcgtgg
aatgcttactttaagaacattgaatcaagtaacgttcctccatccaaggcgttcacggct
ccgccaaccattattcctacagtagcaggaggtgccgccggattcgttccaggatcatca
ccaactaacgaggacgtcgttactcacttgaaggttcaattgttggtccgtgcataccaa
gttagggggcaccaaaaggccaagattgatcctttgggaatctcttttggtgacaacgat
gttgttccaaaggaattgactttagaacactacggtttcaccgaggccgatatggacaag
cagatcaccttaggtcctggtattttacctagatttgccgaaggtggtaagaaatcgtta
acattgagagaaatcatttcaaactgtgaaagattatactgtcaatcgtacggtgttgaa
tacatccacattccatctaaggagcaatgtgactggttaagggaaagaattgaaattcct
gagccatacaagtattctccggatgaaaagagacaaattttagaccgtgtgatttggtct
tgttcttttgaatcattcttggctagtaagttccctaacgacaagagattcggtttagaa
ggtgcagaatccgttgtccctggtatgaaagccatgattgatacctcagttgagttcgga
gtcgaagacattgtcattggtatgccacacagaggtcgtttgaatatgttatctaatgtt
gtccgtaagccaaatgaatctattttctctgaattcactggttcaagagaatttgacgaa
ggttccggggatgttaagtaccatttaggtatgaactacgctagaccaactacatctggt
aagcacgttaacttatctcttgtcgccaatccatctcatttagaatccgaagatggtgtt
gtgttaggtaagactagagctattcaacaatataagaatgacattggcgaatacaaaaag
gctatgtccatcttattacatggtgatgcagctttctctggtcaaggtgttgtttatgaa
actatgggtcttgctaacttaccagattattcaactggtggtactatccatattattgtt
aataaccaaattggtttcactactgacccaagatttgctagatctaccttatacccatct
gatattgccaagtccattaatgccccaattttccacgtcaacgcagatgatgtagaagcc
aatatctttattttcaacttagctgctgaatggagggctaccttccacaccgatgttatt
attgatcttgttggttaccgtaaacatggtcataatgaaactgatcaaccagctttcact
caaccattgatgtaccaaaagattgctgagaagaaacctgttattgattactacaccaag
caattaattgaagaaggtactttcaccaaggaagatattgatgaacataagaaatgggtt
tggaatatcttagacgaatcgttctctaagtcgaaggaatatcaatcaacttctagagaa
tggttaaccactgcttgggaagacttcaagtctccaaaggaattggctaccgaagtctta
cctcatttgccaactgctgttgaagaagacaccttaaagaagatcggtacagctatttca
gaagctccagaaggtttcgaagttcaccgtaacttgaagcgtattttgaatgccagaaag
aagtccgttgaaaccggtgaaggtattgactggtcgactggtgaagccttagcctatggt
tctttagcattagaaggttaccatgtaagagtttctggtcaagatgttgaaagaggtact
ttctctcaacgtcatgctgttttgcatgaccaatcctctgaacagacctacactccatta
aacaatttatctgaggatcaaggtgcatttgttatctgtaactcttcattgtctgaatac
ggtgttatgagtttcgaatatggttactcgttaacttctccagacgctttagttcaatgg
gaagctcaatttggtgattttgctaatactgctcaagtcatcgttgatcaattcatttct
gctgctgaatctaaatggaaacaacgttctggtttagtcctttcattaccacatggttat
gatggtcaaggtccggaacattcctccggtagaatcgaaagatatttacaattgtgtaat
gaagatcaaagatatttcccatctcctgaattgttagaaagacaacatcaagatgccaac
atgcaggttgcttacccaactacaccagcaaatattttccacttgttacgtcgtcaaatg
catagacaattcagaaagccattggtcttattcttttctaaacagttattacgtcatcca
ttagccaagtctgaattatctgaattcactggtgaatctcacttccaatggatcattgaa
gatcccgaattaggtaagagtattaatgctaaggaagacataaaacgtgttattctctgt
tctggtcaagtctttactgccttacacaagaaacgtgctgatattgaagataaatctacg
gctttcatcaaaattgaacaattacacccattcccattcgctcaattacgtgatgcttta
gacagctaccctgcattagaagacttagtctggtgtcaagaagaaccattgaacatgggt
tcctactcttactctgctccacgtattgcaactgtcttagaaaatactgagaaacataag
gataaatctttacgttatgccggtcgtgatccatcagcttctgtagctgccggaactaag
gctatgcataattccgaagaagaagagttcttgaaagaagttttccagaactaa

DBGET integrated database retrieval system