KEGG   Debaryomyces hansenii: DEHA2G04818gHelp
Entry
DEHA2G04818g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G04818p
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha04146  Peroxisome
dha04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dha00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    DEHA2G04818g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    DEHA2G04818g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DEHA2G04818g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HHH_2
Motif
Other DBs
NCBI-GeneID: 2904631
NCBI-ProteinID: XP_461755
UniProt: Q6BJ66
LinkDB All DBs
Position
G:complement(410177..410863)
Genome map
AA seq 228 aa AA seqDB search
MLSSTLRNTVSRGFSNTAAKSTIGAVRTKISLPDLDWDFGALEPHISGQINELHYTKHHQ
TYVNGYNTAIEQQAEAKSKGEVKKTIELQKNINFHGGGYTNHCLFWKNLAPEKQGGGEPP
SSDSELAQRIAAQYGSIENLQSIANAKLAGIQGSGWAFLVKNKENGGSLDVVTTYNQDTV
TGPLVPLLAIDAWEHAYYLQYQNVKADYFKAIWKVINWKEAEKRYLVN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctttcatctactttaagaaatacagtttctcgtggattctcaaataccgctgctaag
agcacaattggagcagttagaactaagatttcattgccagatttggactgggactttggt
gcattagaaccacacatttctggacaaatcaacgaattacattacaccaagcaccatcaa
acttatgtcaatggttacaacacagcaattgagcaacaagccgaagctaagtctaagggc
gaagtcaagaagaccattgaattacaaaagaacatcaacttccatggtggtggatacacc
aaccattgtttgttctggaagaacttggcaccagaaaagcaaggtggtggtgaaccacca
tcgtcggactctgaattggcacaaagaattgctgctcaatacggatcgatcgagaacttg
caatcgatcgccaacgctaaattggccggtattcaaggttctggatgggccttccttgtc
aagaacaaggaaaatggtggatccttagatgttgttactacttacaaccaagacactgtt
acgggaccattagttccattgcttgcaattgatgcttgggaacacgcctactacttacag
taccaaaacgttaaagctgattacttcaaggctatctggaaggttattaactggaaggaa
gctgagaagagatacttagttaactaa

DBGET integrated database retrieval system