KEGG   Debaryomyces hansenii: DEHA2G18876gHelp
Entry
DEHA2G18876g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G18876p
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
dha  Debaryomyces hansenii
Brite
KEGG Orthology (KO) [BR:dha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dha03036]
    DEHA2G18876g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     DEHA2G18876g
Chromosome and associated proteins [BR:dha03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     DEHA2G18876g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl DUF4116 SF3A3
Motif
Other DBs
NCBI-GeneID: 8999247
NCBI-ProteinID: XP_002770664
UniProt: B5RUV2
LinkDB All DBs
Position
G:1533610..1535811
Genome map
AA seq 733 aa AA seqDB search
MSNLRETPDKDDSDEESLITQFETTLTIRPSSNEVHDDGDISIDHTTFIHNNTFGNFTRD
QSIVDIDELQEEEIASEQIPRFKTKKHLQPSLAARVAKSQSLSPSPTPSASDLKYERLLT
PSPLIDYSLTRFTKIFTEFLKSNPHIQKESPRFRKNSDKTLIVLSPYSAEHAFGRKWVTK
SYLSTIFERPQRLLASCIGISSAITMFPFFYKLTNSTKRGSIFSSHVRKIHGKAWPKKLY
ELCLASHEKLQNDDLEVPEDWNTGDIYLTPKTINAIEGVIGTIETAVDSLYMDRHDSHNL
AFVVIRPPGHHSHACLPSGFCLLNNVQIGIEYAFERYGVTHCAILDIDLHHGDGSQDICW
ERAGFAGDYGKDEDDEIDGQGPRDDYGKRFATYPKVGYFSLHDIKSYPTELGYATKENIK
NASTCIMDHDLNIWNVHLQEWSTEEEFYKHYQIKYVNILNRANQFLNHAKKQYDKEYQEY
LVNLAKYNKYVLKPHLYNQPLSKPAPPPPFKPLITISAGFDASEYENPQMQRHGINVPTS
FYATFTKDVVKLAKIHTNGKIVSFLEGGYSDGALSTGIFSHLIGLTNNPNDSHDDELLWN
PTWGSEQVMKELVKGCKKTWVPYKKPQTDVTIWANEVIKLGRSMMPNSILPSGYIYQYEE
PSDKPVKSEYVYEDPVPVNKMVKEILDSDGNVLKDVSYSPLKNDPEDKRRIVRHTRAYYK
KLASAQKQQEASN
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatctacgggagaccccagacaaagatgatagcgacgaagagtcattgatcaca
cagtttgaaacaacattgacaatcagaccttcgtcaaatgaagtgcacgatgatggagat
atatctattgaccatactacatttattcataataacacatttgggaattttactagagat
cagagtattgttgacattgatgaattgcaagaggaggagattgcgctggaacagatacct
aggtttaaaacaaagaagcatttacagcctagtcttgcggccagggtggccaagtctcag
tccctcagcccaagccctactcctagtgcgtccgatctaaagtacgagagacttttgacg
ccttccccattaattgattattcgttaacccgattcaccaaaatctttaccgagttcttg
aagtcgaatccgcatatccagaaggaatcgcccagattccgtaagaatagcgataaaaca
ttgattgttttatcgccatattcggcagaacatgcatttggtagaaaatgggttactaag
tcgtatcttagcactattttcgaaaggccacagaggttattagcatcttgcataggtatt
tcatccgcgattacaatgtttccattcttctataaattaaccaattccaccaagaggggg
tcaattttctcctcgcatgtacgtaagatacacggaaaggcgtggcctaaaaaattgtac
gagttgtgtttagcatcgcatgaaaaattacagaacgacgacttagaggttcctgaagac
tggaacacaggagatatatacttaacgccgaaaactataaacgcaattgagggtgttatt
ggaaccattgagactgcagtcgattcgttgtacatggacaggcatgatagtcataattta
gcatttgttgttattaggcctccaggtcatcattctcacgcgtgcttacctagcgggttt
tgcttgttaaataacgttcagattggtattgaatatgcgtttgaacgttatggcgttacc
cattgtgccatattagatatcgatttacatcatggggatggatcccaagatatttgctgg
gaaagagccggattcgcaggtgattatgggaaagatgaagacgacgagatcgatggacaa
ggtccaagagatgattacggtaaaagatttgctacttatccaaaagttggctacttttca
ttacatgatataaagtcatatccaactgaattgggctatgccacgaaagagaacatcaag
aatgcgtcgacatgcattatggatcatgaccttaatatatggaatgttcaccttcaagaa
tggtccaccgaagaagagttttacaagcattaccaaataaaatacgtgaacattttgaat
agagcaaatcagtttttgaatcacgcgaagaagcagtacgataaggaatatcaggaatat
ttggttaatttagccaaatataataaatacgtattgaagccccatttatacaatcaacca
ctttcgaaaccagctccacctccaccgtttaaacctttaattactatttctgccggattt
gatgctctggagtatgaaaatcctcaaatgcaaagacatggaatcaacgttcctacctcg
ttttatgctacattcaccaaagatgttgtcaaactagctaaaatccacaccaatggaaaa
atcgtttcatttttagagggtggctactctgatggagcattatccactggaatattttct
catcttattggtttaaccaacaaccctaatgactcccatgacgatgaactcttgtggaac
cctacttgggggagtgaacaagtcatgaaggaattagttaaaggctgcaaaaaaacctgg
gtaccctacaagaagcctcaaacagatgttactatctgggccaatgaggttatcaagcta
ggcagatctatgatgccaaattcaattttaccgtcaggttatatctatcaatacgaggaa
ccttccgataagcctgtcaaatcagagtacgtgtacgaagaccctgtgcctgtaaataaa
atggtaaaggagattcttgatagtgacggaaatgtattaaaggacgtttcctacagtcct
ttgaaaaatgatccggaagataaacggagaattgttcgtcataccagggcttattataag
aagttagcttccgcccaaaagcaacaagaagcctcaaactaa

DBGET integrated database retrieval system