KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0568Help
Entry
Dhaf_0568         CDS       T00822                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Dhaf_0568
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dhd03400]
    Dhaf_0568
Enzymes [BR:dhd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dhaf_0568
DNA repair and recombination proteins [BR:dhd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Dhaf_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ACL18634
UniProt: B8FUY8
LinkDB All DBs
Position
626708..629164
Genome map
AA seq 818 aa AA seqDB search
MRSKLNQYNQKRNFTRTLEPEGITEMPQEGLRFVVQHHLARRDHYDLRLEWDGAMLSWAV
PKGPSYNTRDKRLAVQVEDHPLEYRHFEGTIPKGEYGGGVVMLWDEGFWEPYVDVDGGLH
EGMLKFVLKGRRLKGRWALVRMKGKAGDKKDNWLLLKEKDDYVQTADGISQFITSIRTGR
TMTEIEEGEEEKFTRNPFSSTEVQLAKLVRHLPEGEGWLYELKYDGYRIVAYLEGHRVRL
MTRNGHDYTERFQDVASSLADWAEGRAMILDGEMAITDPEGKTDFQALQNYLKNPRTKNL
TYILFDLLALDGADLRGHPLIHRKETLAALLENAPPNLHYSRHVRGKGEESFRAACEAGM
EGIIGKKADALYSGTRNGDWIKLKCDQRQEFIIVGYTLSQKRISGISSLLLGIYEGRELV
YAGRAGTGLKESDMEELEEKFKDIRRSSAPFKPAPKPRANERITWVEPELVVEVKFADWT
EENLLRQASFKGLRADKNPREIRRERADEEKDDGELQLQPPAPERKSLMKINTNSMIIEG
IKISSPDKVIFTDPEITKVDMIRYYAKVAERMLPYVSRRILSIVRCPKGVAQTCFYKKHP
GPGSQGVVTIPILTSDGTTEDYFYIENPSGLIAEAQMGTLEFHIWGSRVDELEKPDLMVF
DLDPDEGMELGTVRQGVRDLKTILAELSLNSYLKTSGGKGYHVVVPLKPAVSWGVFHDFA
QGVAQVMEQKWPDRYTSNVRKAKRTNRIFIDWIRNGRGATSIAPYSLRARRGAKVSMPIT
WEELDTVAPDGVDMAEALRRIQDSDPWEGFFRNQQRLQ
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcaaaactcaatcagtacaaccaaaaaaggaatttcaccagaaccttggagccg
gaggggatcacagaaatgccccaggaggggctgaggtttgtagtgcagcaccatctggcc
cgcagagatcactacgatcttcgtctggaatgggatggagccatgttaagctgggcagtg
cccaaggggccttcctacaatacccgggataagagactggctgtacaggtggaggatcat
cctttggaatacaggcattttgaggggaccattcccaaaggggaatacgggggcggtgtg
gtcatgctctgggatgaaggcttctgggaaccttatgtggatgtggatgggggactccat
gaaggtatgctgaagtttgtactgaagggcagaaggcttaaaggcaggtgggctctggta
cggatgaaagggaaagccggggacaagaaggataactggttgttgcttaaagaaaaagac
gactatgtgcaaactgccgacggaatttcccaatttatcaccagcatcaggaccggacgc
accatgacggaaattgaagaaggggaggaggaaaaattcacccgaaaccccttcagcagt
acggaagtgcagcttgccaaattagtccgtcaccttcccgagggtgagggctggctttat
gaattgaagtatgacggctatcggatcgtggcctatcttgaagggcacagggtccggctt
atgaccaggaacggccatgattatacagagcggttccaggatgtggcctcttccctcgct
gattgggctgagggaagggccatgattctggatggggaaatggccattacggatccggag
ggcaagacggactttcaggctttgcagaactatttgaaaaatccccggaccaaaaacctg
acctatatcctctttgatctcctggccctggatggagccgacttgcggggacaccccctg
atccacaggaaggaaaccctggcggccttgctggagaatgctcccccaaaccttcactac
agccggcatgtgaggggaaagggcgaagaaagtttccgggcggcttgtgaagcaggcatg
gaggggattatcggcaaaaaagccgatgccctttacagcggaaccaggaacggcgactgg
atcaagctgaaatgtgatcaaaggcaggaattcatcatcgtcggctatactctttcccag
aaaagaatcagtgggatcagctcccttctcctgggtatttacgaaggccgggaattggtc
tatgccggccgggccggtaccggcctgaaggaaagcgacatggaggaacttgaagagaaa
tttaaggacatcaggagaagttcggcgccctttaaacctgctcctaagcccagagccaat
gaacggatcacctgggtggaacctgaactggtggtggaggttaagtttgccgattggacc
gaagagaatctattgaggcaggccagcttcaaaggcttgcgggcggataagaaccccagg
gagatcaggagggagagggcggatgaggaaaaagatgatggggaactgcagcttcagcca
cctgcccctgaaaggaagagcctcatgaaaatcaataccaacagcatgattatcgaagga
atcaagatcagcagtccggacaaggtgatcttcaccgatcctgaaatcaccaaagtggat
atgatccggtattacgccaaggtggcagagcgcatgctgccctatgtaagccgccggatt
ctcagcattgtccgctgtcccaaaggggtagcccagacctgcttttataagaagcatccc
ggccccggcagtcagggagttgtcactattcccattctcaccagtgacggaacaacagag
gactacttctatattgagaacccttccgggctgatcgccgaagcccaaatgggcactctg
gaatttcacatctgggggagccgtgttgatgagctggaaaagccggatctgatggtcttt
gatctggaccccgacgagggaatggagctgggtacggtgcgccagggtgtgcgggatctg
aaaaccatccttgccgagctttccctgaactcctatctcaagaccagcgggggcaaagga
taccatgtggtggtccccttaaaacccgccgtttcctggggagtctttcatgatttcgcc
caaggcgtcgcccaggtcatggagcagaaatggccggatcgttacacaagcaatgtgcgc
aaggccaagcgcaccaacaggatcttcatcgactggattcgcaacggccggggagccacc
agcattgccccctattccctgagagcaagaaggggagccaaggtatccatgcccatcact
tgggaggagctggatacagtggctcccgacggtgtggatatggcggaggccctgcgcagg
atccaggacagtgatccctgggaagggtttttccggaatcagcagcggcttcagtga

DBGET integrated database retrieval system