KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_1520Help
Entry
Dhaf_1520         CDS       T00822                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00970  Aminoacyl-tRNA biosynthesis
dhd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dhaf_1520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dhd03029]
    Dhaf_1520
Enzymes [BR:dhd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dhaf_1520
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dhaf_1520
Mitochondrial biogenesis [BR:dhd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dhaf_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey zf-Di19 YqeY
Motif
Other DBs
NCBI-ProteinID: ACL19572
UniProt: B8FP47
LinkDB All DBs
Position
1619244..1620698
Genome map
AA seq 484 aa AA seqDB search
MSIFERYEMVCGVEVHVELATKTKIFCNCSTEFGGEQNTHVCPVCLGLPGVLPVLNREVV
NLAIKAGLALNCDIADFSKFDRKNYFYPDAPKNFQTSQYDLPICKNGWLEFAVDGEKKRV
GITRAHMEDDAGKLVHSGATISTSEESFVDYNRTGVPLLEIVSEPDMRSIAEVVSFLEEM
VRTIQYTEVSDCRMEQGSVRFDINVSLRPHGQKEFGTRTETKNLNSFSSVRRCLEYEIER
QARLLDDGEKVIQETRTWDEGKGVTLSLRSKEEAHDYRYFPEPDLVPLVIAREWVEEIRQ
TLPEMPGARRERYQSLGLTEYDAGVLTAAKALSDFFDEALQSYSDAKALANWVMGEFTRL
LNAKQISVEESPVRPSQLAELLTLIEKGAISGKIGKTVIEAMFESGKDPEVIIKEKGLAQ
ISDTAALLKLVDEVIAAHPQSVEDYKAGKDRAIGFLVGQIMKATKGQANPGVVNDLLKEQ
LAKF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttgaacgttatgaaatggtctgcggcgtggaagttcatgtggagctggcc
accaagaccaagattttctgcaattgctccactgagtttgggggagagcagaatacccat
gtctgccccgtttgcctggggctgcccggagtattgccggtcctcaaccgtgaagtggtc
aatctggccattaaagcaggtctggctttaaattgcgacattgccgacttctctaaattc
gatcgtaagaattacttttatcccgatgcccccaagaactttcagacatcccaatatgat
ctgcccatctgcaaaaacggctggttggaatttgcagtggacggagaaaagaagcgggtg
ggcataacccgggcccatatggaagatgatgccggaaaattggtgcatagcggtgccacc
atctccacctcggaggagtcttttgtggattacaaccggaccggagtgccgctcctggag
attgtctcagaaccggatatgaggtctattgccgaagtggtaagctttttagaagaaatg
gtgcggaccattcagtacacggaagtctccgattgccggatggaacaaggctcggtccgc
tttgatatcaatgtgtccctgcgcccccacggacagaaggagtttggtacccggaccgaa
acgaagaatctcaattccttcagctcggtacggcgctgcctggaatatgaaattgagcgg
caagcccggcttttggatgatggggaaaaagttattcaggaaacccggacctgggatgag
gggaagggagtcaccctttccttgcgttctaaagaggaggcccatgattaccgctatttt
cctgagccggatctggtgcccctggtcatcgccagggagtgggtggaagaaattcgtcaa
acccttccggaaatgcccggggctcgccgggaacgctatcagtccctgggactgacggaa
tatgacgcaggagtgcttaccgcggcgaaagcgctgtcggatttttttgatgaagcgctg
cagagctatagcgatgccaaggccctggccaattgggtgatgggggaattcacccgtctc
ctcaatgccaaacaaatcagtgtggaagaatccccggttcggccctctcagctggctgaa
ctcctgactttgatcgaaaaaggtgccatcagcggtaagatcggcaaaacggttatcgaa
gcaatgtttgaatccgggaaggatccggaagttatcatcaaggagaagggcttagcccaa
atcagcgatacggctgccttgttgaagctggtggatgaagtgattgccgctcatccccaa
tcggtggaagattataaggccggcaaagaccgggccatcggtttcctggtcggccagatt
atgaaggccactaaaggccaggcgaaccctggcgtggtcaacgacttgctgaaggagcag
ctggcgaaattttaa

DBGET integrated database retrieval system