KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2181Help
Entry
Dhaf_2181         CDS       T00822                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00010  Glycolysis / Gluconeogenesis
dhd00053  Ascorbate and aldarate metabolism
dhd00071  Fatty acid degradation
dhd00280  Valine, leucine and isoleucine degradation
dhd00310  Lysine degradation
dhd00330  Arginine and proline metabolism
dhd00340  Histidine metabolism
dhd00380  Tryptophan metabolism
dhd00410  beta-Alanine metabolism
dhd00561  Glycerolipid metabolism
dhd00620  Pyruvate metabolism
dhd00625  Chloroalkane and chloroalkene degradation
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01120  Microbial metabolism in diverse environments
dhd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dhaf_2181
   00053 Ascorbate and aldarate metabolism
    Dhaf_2181
   00620 Pyruvate metabolism
    Dhaf_2181
  Lipid metabolism
   00071 Fatty acid degradation
    Dhaf_2181
   00561 Glycerolipid metabolism
    Dhaf_2181
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dhaf_2181
   00310 Lysine degradation
    Dhaf_2181
   00330 Arginine and proline metabolism
    Dhaf_2181
   00340 Histidine metabolism
    Dhaf_2181
   00380 Tryptophan metabolism
    Dhaf_2181
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dhaf_2181
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dhaf_2181
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dhaf_2181
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Dhaf_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACL20215
UniProt: B8FSK4
LinkDB All DBs
Position
2351612..2352982
Genome map
AA seq 456 aa AA seqDB search
MPDIKEILVKQKAFFQTGKTKELQFRVDMLNKLRSAIKIHEEEIMAALKADLNKAPFEAY
ATEVGMVLEELNYTLKHISSWVKPKRVRTPLVHFPSASYLYTEPYGSVLIMSPWNYPFQL
ALAPLVGAISAGNCAVLKPSEYSANTSAMIERIVKEIFDESFVAVVRGGREANKTLLNEK
FDYIFFTGSVGVGKTVMESAARHLTPVTLELGGKSPCIIDDTADLELAAKRIVWGKFLNA
GQTCVAPDYLLVHRTVKEKLIQEIKKSITAFYGHDPLGNEDYPKIINQKHFERLLGLLKS
GRVVEGGRSDEKTRRIAPTILDDVTWESPVMQEEIFGPLLPVLEFESFDAALAMVNQHPK
PLALYLFTRSKDHEAQAISKTSFGGGCINDTIIHLANPNLRFGGVGESGMGQYHGKGSYD
TFSHTKSIMKKSNKLDIPLRYPPFRNHLSLLKKLMK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgccggatataaaagaaattttagtcaaacaaaaggcttttttccagaccgggaaaacc
aaggagcttcagtttcgggtggatatgctgaataaactgcggtcagccataaaaatccat
gaggaggagattatggcggctttgaaggctgacctgaataaagcgccttttgaagcctat
gccacagaagtgggcatggtactggaggaactcaactatacgcttaaacatatctcaagc
tgggtcaaacctaaacgtgtgcggactcctctggtgcactttccttccgccagctatctt
tatacagaaccctacggctccgttctgattatgtcaccctggaattatccctttcagctg
gccttggctcctttggtgggggctataagtgcaggaaactgcgccgtcctcaagccttcg
gagtattcggccaacacttccgcaatgatcgagaggatagtcaaagaaatctttgacgag
tcctttgtggctgtggttcgtggaggcagagaagccaacaaaaccctgctcaatgaaaag
tttgactatatcttttttaccggcagcgtcggggtgggaaaaacggtgatggaatccgcc
gccagacacctgaccccggtaactctggaattgggcgggaaaagcccctgtattatcgat
gacactgccgatcttgaattggcggccaaaagaatcgtctggggaaaatttctgaatgcg
ggacagacctgtgttgcgccagattatctgcttgtgcataggactgttaaagaaaaactc
atccaggagatcaagaaatccattactgccttttatggccatgatcctttaggcaacgaa
gactatcctaaaatcatcaatcagaagcacttcgagcggcttctaggcttgctgaaaagc
gggcgggttgtagaggggggccggtccgatgagaaaaccaggcggattgcgcccaccatt
ctggatgatgtaacctgggaaagcccggtgatgcaggaagaaatctttggacccctgctg
ccggtgctggaatttgagagctttgacgctgcccttgctatggtcaatcagcatcccaag
ccgctggctttgtatctgttcaccagaagcaaggatcatgaggcccaggccatcagcaaa
acgtccttcggcggcggatgcatcaatgatacgattatacatctggctaaccccaatctg
cgctttggaggtgtgggggagagcggcatggggcagtatcacggcaaaggaagctatgac
accttttcccatacgaaaagcattatgaagaaatccaataagctggatatcccgcttcgg
tatccgcccttcagaaatcatttgtctctgcttaagaagcttatgaagtaa

DBGET integrated database retrieval system