KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4532Help
Entry
Dhaf_4532         CDS       T00822                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00071  Fatty acid degradation
dhd00362  Benzoate degradation
dhd00650  Butanoate metabolism
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
dhd01200  Carbon metabolism
dhd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dhaf_4532
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dhaf_4532
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dhaf_4532
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dhaf_4532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA NAD_binding_2 DAO NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACL22533
UniProt: B8FWN5
LinkDB All DBs
Position
complement(4819776..4822163)
Genome map
AA seq 795 aa AA seqDB search
MAIYKVAVLGSGVMGSTIAAHLANAGIPSILLDIVPPSLLPEEEAAGLTLASPQVRNRFA
ASNKAKLIKMNPAPLFVPEFADRIEVGNFEDDLPRLQEVDWVIEVVVERLDIKIDLFKKV
AQHVRPGTIVTSNTSGISLKSMTEGLPEEFTKSFFGTHFFNPPRYMKLFELIPGPNTDPT
VIQEMEEFAERVLGKGVVYAKDTPNFIANRIGVFGLAATIREMQRSGLTIDEVDALTGPV
MGRPKSASFRTVDMVGLDTFVHVANNVGDNVPEEKEFFVMPDFIHTMIKNGWLGDKSKQG
FYKKVKTAEGKEVLVLDPHTMEYVPKKKVKFACLDKAKNAGGLKDKMKTLVNGKDPGAEF
AWNVLKEVLLYAARLAPQIADDLTALDAGMKLGFNWEMGPFETWDALGVKATAERIAAEG
GTLPEIVAKLLAEGKDSFYEKTEGGDTLYYAGGEYKEKAASPYSFSLKKAHKQGKKIFGN
SGASLVDMGDGVACLEFHSPNNSIGGDIMNMIHKSLAEVEKNYLGMVIGSQGKNFAVGAN
LMLIMMEAEEGNWDDLDLMVREFQRGTMALKYAKKPVVAAPYGMTLGGGTEVCLHSHAIQ
PAAETYMGLVELGVGLIPGGGGTKEMALRAMEGILPGVVVAPDYFFAKRFEVVAMAQVST
SAEMARKLGFLRASDRCSMNADHVLLDAKARVLDLARDFRPIIPQKVKAAGPGVCAFLEM
ALYGMKEGRYISEYDAHLGKKLAYAMTGGDVLAGTLVDEQYLLDLEREVFLSLAGEPKTL
DRIRHMLTKNKPLRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggccatctataaagtggcggttttaggctcaggggttatgggaagcaccatcgcggcc
catctcgccaatgccgggattcccagtatactgctggacatagtaccccctagtttgttg
ccggaggaagaagcggccgggctgaccttggcatccccccaagtcagaaatcgttttgcc
gcatccaacaaagccaaactcatcaagatgaaccctgctccgctgtttgtgccggaattt
gcggatcgcatcgaagtcggcaattttgaggatgatctgccccgtttgcaagaagtggac
tgggttattgaagtggtcgtagagcgtttggacatcaaaatcgacctctttaagaaggtg
gcccagcatgtccgcccggggaccattgtaacatccaacacttccggtatttctttaaaa
tccatgacagaagggcttcctgaagaatttaccaagagctttttcggcacccacttcttt
aatcctccccgttatatgaagctttttgaactgattcccggacccaacacggatccgacc
gttattcaggagatggaagagtttgccgagcgggtgctgggcaaaggggtcgtctatgct
aaggatacgcccaacttcatcgccaaccgcatcggcgtctttggtttggcggcaaccatc
agagagatgcagcgttccggcttaaccatcgatgaagtggatgctttaaccggaccggtg
atgggacgtcctaagtcagcctccttccggaccgtggatatggtgggtctggacaccttt
gtccatgtcgccaataacgtgggagataatgtccctgaagaaaaagagttcttcgtcatg
ccggactttattcataccatgatcaaaaacggctggctgggagataagagcaagcagggg
ttctataaaaaagtcaagacagcagaaggcaaagaagtactggttcttgatccccatacc
atggagtatgttcccaagaagaaagtcaaatttgcctgcctggataaagccaagaatgcg
ggcggtcttaaagataagatgaaaaccttggtcaacggcaaagatcccggggctgaattc
gcctggaatgtcttgaaggaagttctcctttatgcggcccgcctggctccccaaatcgcc
gatgatcttacagctcttgatgccggtatgaagctgggcttcaactgggaaatgggacca
tttgagacctgggatgccttaggcgttaaagccaccgcggagcgcatcgcagctgagggc
gggaccttgcctgagatcgtggcaaaactgctggctgaaggcaaagacagtttctatgag
aagaccgaaggcggggacactctgtactatgccggaggcgaatataaggaaaaggccgcc
agcccctattccttctcccttaaaaaggcccataaacaaggcaaaaaaatcttcggcaat
tccggtgccagcttagttgatatgggtgacggtgtagcctgcctggaattccattcaccg
aacaactccatcggcggggatatcatgaacatgattcacaagtccttggcagaggtggaa
aagaactatttagggatggtgatcggcagtcagggtaagaatttcgccgttggtgccaac
ctgatgctgattatgatggaagcggaagaaggcaattgggatgacctggatctcatggtc
cgcgaattccaaaggggaaccatggccctgaaatacgccaagaagcctgtggtagccgct
ccctatggcatgactttaggcggtggaactgaggtttgcctccattcccatgccatccag
cctgcggctgagacctatatgggcctggtggagctgggcgtgggcctcatccccggcggc
ggcggcaccaaggaaatggccctgcgcgctatggaaggaattcttcccggcgtggtcgtt
gctccggactatttcttcgccaaacgcttcgaagtagtggccatggcccaggtttccacc
agtgcggaaatggccagaaagcttggcttcttaagggcaagtgatcgctgcagtatgaat
gccgaccatgttctcctcgatgccaaggcccgtgtccttgatctggcaagagacttccgc
cccatcattcctcagaaggtcaaagcagcaggaccgggagtctgtgccttcctggaaatg
gccctgtatggcatgaaagaggggcgttatatctccgaatacgatgctcacttagggaaa
aaactggcttatgccatgaccggcggcgatgttctggccggaactttggtggatgagcaa
tatctcctggatctggaaagagaagtgttcttaagccttgccggagaacccaagactctg
gatcgcatccggcatatgctcaccaagaataagccattaaggaattag

DBGET integrated database retrieval system