KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4855
Entry
Dhaf_4855         CDS       T00822                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00300  Lysine biosynthesis
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Dhaf_4855
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Dhaf_4855
SSDB
Motif
Pfam: NAD_binding_7 AlaDh_PNT_C 2-Hacid_dh_C HI0933_like FAD_binding_3 Pyr_redox_2 3HCDH_N
Other DBs
NCBI-ProteinID: ACL22850
UniProt: B8G0B4
LinkDB
Position
complement(5175525..5176364)
AA seq 279 aa
MTRLQVRDIESILRQMNIYDAELLAKTGYRLAHIAAHAVGRLSADIPDPGLIAVVPMTCG
LGVISGFAETVAGILGFLGMRAFVPVSPDVKGFAEALERGAEIIFMADEERFIGVHLKTG
QISDNSEATGRGFAAALDCLTGGLKERDVLVIGTGPVGRAAAFAVLDFGGHVHVLDKELT
VSEKLAQDILCQRSCSIGIERELDSAMHKHRAIVVACPEGGLIRADHLHTDTCIAAPGVP
LGIQAQAIKKVEGRLVHDPLQLGVATMLYEILAKISPPA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgactcgtcttcaggtaagggatatcgaatcaatcctccggcagatgaacatatatgat
gcggaactattggccaaaaccgggtataggcttgcccatattgccgcccatgccgttggc
aggctttcggcagatattcctgatccggggttaattgccgtagtgccgatgacctgcggc
ctgggtgtgatcagtggttttgcggagacggttgccggaattctgggtttcctgggcatg
agggcctttgtgccggtctctcccgatgtcaagggattcgctgaagcgctggaacgcgga
gcggaaattatctttatggccgatgaagagcgttttattggggtccatttgaaaacgggg
cagatctcggacaacagcgaggcaacaggccggggctttgcggctgctcttgattgcttg
accggcggccttaaagagcgggatgttctggtcataggcaccggtccggtggggcgggct
gccgctttcgccgtccttgatttcgggggccatgtccatgtccttgataaggagttgacc
gtgagcgaaaaattagctcaggacatcctctgtcaacgcagctgctctattggcattgag
agggaattggattcggcgatgcacaagcatcgggccattgtggtggcctgtcctgaaggg
ggattgatcagagcggatcatcttcatacggatacctgcatagctgcgccgggggtgccg
ttgggtattcaggctcaagccatcaagaaggttgaggggcgtttggtgcatgatcctctg
caattaggtgtggcgacaatgctctatgagattcttgccaaaatatcaccgccggcataa

DBGET integrated database retrieval system