KEGG   Drosophila hydei: 111592509
Entry
111592509         CDS       T05888                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dhe  Drosophila hydei
Pathway
dhe00230  Purine metabolism
dhe01100  Metabolic pathways
dhe04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111592509
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111592509
Enzymes [BR:dhe01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111592509
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNF-1_N Raftlin
Other DBs
NCBI-GeneID: 111592509
NCBI-ProteinID: XP_023160501
UniProt: A0A6J1L480
LinkDB
Position
Unknown
AA seq 1168 aa
MPEEKASNLENGQTTAASTPSKTKRQRTPTRRRPPNEGDVVAGGVGITGGGVVILPQHVL
NELYHNYSIKQRRSGLKWFLFAAILFNIWTICIPWEQALPTRVVNCSMLLAYLALTALLH
IGRRSEQPALKRFHHSLLTIVPRALWFLSMLHFAAYEMLQANFSPRDVLGWAILLNFLIY
VTLPLPLIFLGLVIGFCTYFNCLSLPVGFSRLDPLISDQAAANAVLIATAALIGLLYYFM
GEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKI
YMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCY
YCISGAPDERPDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQW
QFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGLKTY
FITKVVKPFASPCGKKINELKSENANHSPDSNASSNSSNESNDCADDDNDATVDDEELLA
QSVVINGHSPTAAEDEEEQIKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQA
YAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVAISIAESF
SGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHIVSESEFN
ATGGLEEVATAEHLLPESFVEQMREAVPTERVLYPSYLSNFSVLILIAIAVIAQLTHLTK
ILLLLSIAALHCYFNVCIMQDLYTLEDDLAHQPVISTRYCASGLLLVAALSLSFLARHMD
HEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYA
EVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGST
YMAASGINLQRNLRNDAPITERWSHLAVLVEFALELKHALQGINEQSFNHFVLKMGINHG
PITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAVQVTEETCNILEQFGYTFLQRGLVA
VKGKGQLMTYYLQGKSESSAAEPKAAVELHEKETVAAAAPVSLECSTELEADIKTPLLKL
KAQDAATEAAAETCLGNGTVGESQSLLE
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgccagaagagaaggcatcaaatcttgagaatggccaaacaacggcagcatccacacca
agcaaaaccaaacggcaaaggacaccaacacgacgtcgcccgccaaatgagggcgatgtc
gtcgctggaggcgtgggcattaccggcggcggtgtggtcatcctgccccaacacgtactc
aacgaactctatcacaactattccattaagcagcgacgcagcggccttaagtggttcctg
tttgcggccatcctctttaatatctggacaatttgcataccctgggagcaggccttaccc
acaagagtggtcaattgtagcatgttgttggcctacctggcactgacagctttactgcac
attggacgacgttcggagcagcctgccctgaaacgcttccatcactcgctgttgacgatt
gtgccgcgagccttgtggttcctatcgatgctccatttcgccgcctatgagatgctgcag
gccaacttctcgccgcgagatgttctcggctgggcgattttattgaacttcctaatatat
gtgacgttgccattgccgctgatttttctgggcttagtcattggcttttgcacgtacttc
aattgcttgagcctgcccgttggcttttcacgtctagatcctttaatctccgatcaggcg
gcggccaatgccgtcttaatagccaccgcagcattaattggtctattatattactttatg
ggcgaggcgaagcagaagcgcgcctttttggaggccaaaaagagtctggaggtgaagatg
gtcatagaggagcagtcggcagaacaggaacgcttgttgttatccgtgctgcccaagcat
gtggctattaagatgcgcgaagacctgggctcatccagttcggaggcctttaagaagatc
tacatgagtcgacatgagaatgtcagcatactgtatgcggatattgtcgggtttaccgcc
atctcctcaacgtatagcgcccaagatctggtaaaaatgctaaacgagctcttcgcacgc
ttcgataggctcgccgagaaataccaacaactgcgcattaaaattctcggtgattgctat
tattgcattagcggagcgcccgacgagcggccggatcatgccgtgctctgcgttcacatg
ggactttccatggtgaaggccatcaaatatgtgcagcaaaaggcaaactcacctgttgat
atgcgtgtgggcatacacaccggtgctgtcctggctggcatacttggccagcgtcaatgg
caatttgacgtttactccaaggacgttgagctggctaataaaatggaatccagcggcaaa
gccgggcgtgtacacatttccgacaaaacgttggcctttctcaatggcgagttcgaggtg
gagcccgcctttggtgagaagcgcgaggagctgctgcgcatagctggcctgaagacctat
ttcattaccaaagtggttaaaccgttcgcctcgccctgcggcaagaaaatcaacgaatta
aagtcggaaaatgccaatcatagtcccgattcgaatgccagcagcaacagcagcaatgag
agcaacgattgtgctgacgacgacaacgatgccaccgtggatgatgaggagctgctggcg
caaagtgtcgtcatcaatggacacagtcccacagccgccgaggatgaggaggaacaaatc
aagctggagaacttcaagcaacgactcaaagatgaactggtcacacgcgatggacatgaa
aatctcaccaaggacacgaacatctttttgcgcttcaagaatccgcagctggagcaggcc
tatgccgtctatcgcgagccgtacagctcgctgcccttgctggccgccctgctggtgcag
tgcatcgatgttttgtattcctatttggtgttgcctcgctcgacgctgcatttcattaac
attgccgcgccgctggtgcccattgccatgctggtggccattagcattgccgaaagcttc
agcggcatgctgcccaagttctttgtggatgtgagcaagcgattcaatgacattaccttc
gttcgtgagctggcggccataattatagcgcttactattggcctcagcaatgtcatcgac
atgtttttctttgtcaccttcgtgcgcaccgagcacattgttagcgagagcgaattcaat
gccacgggcggcttagaggaggtggccaccgctgagcacctgctgcccgaatcgtttgtg
gaacagatgcgtgaagcggtgccaaccgagcgtgtcctatatccgtcctatttgagcaac
ttcagtgtcctcatactaatcgcaattgctgtaattgcgcagctcacacacttgaccaaa
atcctgttgctgctgtccattgcagctctgcattgttatttcaatgtgtgcattatgcag
gatttgtacactctggaggatgatctggctcatcagcctgttatatcaacacgttattgt
gcttcaggtctgctgcttgtggcggcattgtcactcagctttttagcaagacatatggac
cacgaggatcgtgttattttcaaatggaaaactgaagtggccgagcaaaaggaaaccgcc
aacgatatgcgtcaacgcaatgaggctttggtctataatgtgctgcccgtgcatgtggcc
gaacattttatgaagaacacaaagcgctcccacgatgatctctactctcagagctatgcc
gaggtaggcgttctcttcgccagcatgcccaacttttcagatttctattcggaggaaact
gttaacaatcagggtctggagtgtttgcgttttctgaatgaggtcatttccgattttgat
gcgttgttggagctgccacaatttcaggacatcatcaaaattaagacaattggatcgact
tatatggctgccagtggcattaatttgcagcgcaatttacgcaatgatgcgcccattacc
gagcgctggtcccacttggcggttctggtggaatttgcactggagctaaagcatgcgctg
cagggcatcaatgagcagtcattcaatcatttcgtactcaaaatgggcatcaatcatgga
cccattacggcgggtgtgattggcgcccggaagccacactacgatatctgggggaataca
gtgaatgtggcctccagaatggagagcactggcaaagcgggcgccgtacaggtgaccgag
gaaacctgtaacatattggagcaattcggctatacgtttctgcagcgcggcttggtggct
gtcaagggcaagggtcaactgatgacctactatctacagggtaaatctgagagcagcgcc
gcggagccaaaggcagctgtagagctgcatgagaaggagacagtggcagctgcagctccg
gttagtctggagtgcagtaccgagctggaggcagatattaagacaccactgctgaagctt
aaggcgcaggatgcagcaacagaggccgctgcagaaacatgtttaggcaatggaaccgtt
ggggaatctcaatccttgttggagtga

DBGET integrated database retrieval system