KEGG   Drosophila hydei: 111595070Help
Entry
111595070         CDS       T05888                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dhe  Drosophila hydei
Pathway
dhe00020  Citrate cycle (TCA cycle)
dhe00190  Oxidative phosphorylation
dhe01100  Metabolic pathways
dhe01200  Carbon metabolism
Module
dhe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dhe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dhe_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111595070
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111595070
Enzymes [BR:dhe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111595070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 111595070
NCBI-ProteinID: XP_023164398
LinkDB All DBs
Position
Unknown
AA seq 666 aa AA seqDB search
MSGIMRAPSILAKNAFASMQRVATVAAAATQQHRGYHITPGQQQSKSANPDAISKQYPIV
DHAYDAIVVGAGGSGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDD
WKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSL
KFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLAIN
LEDGSLHRFRARNTVVATGGYGRAFFSCTSAHTCTGDGTALVARQGLPSEDLEFVQFHPT
GIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSRSITIEVMEGRGVG
PEKDHVFLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGIPTNYR
GQVLTIDSNGKDKIVPGLYAAGEAACSSVHGANRLGANSLLDLVVFGRACAKTIAEENKP
GAPAPELKDNAGEFSVANLDKLRHANGSITTADLRLKMQRCMQNHAAVFRDGPILKKGVS
EMKEIYKQFKDVKVIDKSLVWNSDLIETLELQNLLANAQMTIVGAEARKESRGAHAREDF
KQRIDEYDYSKPLESQQKKPIEEHWRKHTLAWVCNDDGDVDLKYRPVIDETLDKEVETVP
PAIRSY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaattatgcgtgcgccatcgattttggccaaaaatgcattcgcctcaatgcaa
cgtgtggcaacagtggctgccgcagcgacgcagcagcatcgcggctatcatataacgccc
gggcaacagcagtcgaaatcagcgaatcccgatgccatctccaagcaatatccgattgta
gatcatgcatacgatgcgattgttgtcggggccggcggctcgggactgcgcgctgccttt
ggcctggtcgctgaagggttccgcacagcagtaattacgaaattgtttcccacacgctcc
cacacgattgctgctcagggtggcattaatgctgcgcttggcaatatggaggaggatgac
tggaagtggcacatgtacgatacggtcaagggcagcgattggctgggcgaccaggatgcc
atacattatatgacacgcgaggcacccaaggctgtcattgagctggagaactatggcatg
cccttctctcgcacccaggacggcaagatctatcagcgcgcctttggtggccagagtctg
aagtttggcaagggcggtcaggctcacagatgttgcgctgttgcggatcgtaccggtcac
tcgctgctacacaccctgtacggtcagtcgttgagctacgattgcaattactttgtcgag
tactttgccctggatctgatcttcgaagatggcgagtgccgtggcgtgctggccattaat
ttggaagatggcagccttcatcgtttccgtgcacggaatacggttgtggccaccggtggt
tatggacgcgccttcttttcctgcacctcggcgcatacgtgcactggagatggtaccgca
ttggtggcacgtcagggcctgccctcagaggatttagagtttgttcagttccacccgacg
ggtatctatggtgccggctgtcttataactgagggctgccgcggcgagggtggctatctg
atcaattctaagggcgaacgtttcatggagcgctatgcgcctgttgccaaggatttggct
tctcgcgatgttgtctcccgctccattaccattgaagtcatggagggccgtggtgttgga
cccgaaaaagatcatgtatttctacagctgcatcatttgccgcccaaacagctagctgaa
cgtctacccggcatttcagaaactgctatgattttcgccggcgtcgatgtgacccgcgag
cccatccccgtgttgcccaccgtgcactacaacatgggtggtattcccactaattatcgc
ggccaggtgctcaccattgacagtaacggcaaagacaagattgtgcccggtctctatgcg
gccggtgaggcagcctgtagctcggtgcatggcgctaatcgcttaggcgccaactctctg
ctggatctggtggtctttggccgtgcctgcgctaagaccattgctgaggaaaacaaacct
ggtgcgccagcgcccgagctgaaggataatgctggggagttctctgtggctaatttggat
aaactgcgccatgcaaatggtagtataaccactgctgatctgcgtctgaagatgcagcgt
tgcatgcaaaaccatgctgctgtattccgcgatggtcccatcttgaagaagggcgttagc
gaaatgaaggagatttacaaacagttcaaggacgtcaaagttattgacaaatcacttgtg
tggaactctgacctgattgagacactggagctgcagaatctgctggccaatgctcagatg
actattgtcggagccgaagcgcgcaaagaatcacgcggtgcccacgcacgcgaagatttc
aagcagcgtatcgatgaatatgactatagcaagcccttggagtcgcagcagaagaagccc
atcgaggagcattggcgtaagcacacgctcgcctgggtgtgtaacgatgatggcgatgtg
gaccttaaatacagaccagttatcgatgagacgctggacaaggaggtcgagacggtacca
ccagcaattcgctcctattag

DBGET integrated database retrieval system