KEGG   Drosophila hydei: 111599228
Entry
111599228         CDS       T05888                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
dhe  Drosophila hydei
Pathway
dhe04013  MAPK signaling pathway - fly
dhe04214  Apoptosis - fly
dhe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    111599228
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111599228
   04215 Apoptosis - multiple species
    111599228
SSDB
Other DBs
NCBI-GeneID: 111599228
NCBI-ProteinID: XP_023170594
UniProt: A0A6J1LXZ9
LinkDB
Position
Unknown
AA seq 384 aa
MAVPFHLPVEERDDIASSSSGTSNSSGASTSSGASSSSGASDGASSIASQSPNTTSSATQ
TPMQSPLPTDQVLIALCEWYQQHQRHYINNANATAPHIFQYPPPPSPSCSMAQSPSYTGG
DIFFAHGVYVPPPPQPQQPPRTPRSSMSFAGGEELNFFRQPYPAPTTPQPMPPQPPAPQS
APPMHYSHSYPQVSHMLQHHHPASYGHPLPAGAYYATYTPPPTPNTANASTSTSAGATAM
PFGRYGVHGPVMASTPLAPTGPKMRLQRSQSDAARRKRLTSTGEDEREYQSDHETSWDEF
DDRYDNFTAGRERLQEFSGRIPPRKKKTNSSSNSNANPCSSTANESNCSQQRETNKEKEQ
QSFTWPTVVTVFVLAMGWGLYAAR
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctgtgccctttcatctgcctgtggaggagagagatgacatcgcctcgagctcatcg
ggcacctcgaactcgtcgggcgcatcgacatcgtcgggcgcctcctcatcgtcgggcgcc
tcagatggcgccagcagcatcgcctcccagtcacccaacacaaccagctcggccacgcag
acgccgatgcagtcgccgctgcccacggaccaagttctaatcgccctctgcgaatggtac
cagcagcaccagcgacactacatcaacaatgccaatgccacggccccgcacatctttcag
tatccgccgccgccgagcccctcgtgctcgatggctcagtcgcccagctatacgggcggc
gatatattctttgcccatggcgtttatgtgccgccgccgccgcagccgcagcagccacct
cgcacgccacgcagcagcatgagctttgcgggcggggaggagttgaacttcttccggcag
ccgtatccggcgccgacaacgccacagccaatgccaccgcaaccgccggcgccgcagtcg
gcgccgccgatgcactacagccacagctatccgcaggtctcgcacatgctgcagcatcat
catccagcctcctatggacatccgttgccggctggcgcctactacgccacctacacgccg
ccacccacgccgaacacagcgaatgcctccacctcgacctcggctggcgcaacggccatg
ccctttggccgttacggcgtccatggcccggtcatggcatcaacgcccctggcgccaacc
ggccccaagatgcgtctgcagcgcagccaatcagatgcggccagacgcaagcggctgacc
tcgacgggcgaggatgagcgcgagtatcagagcgatcatgagaccagctgggacgagttt
gacgatcgctacgacaattttacggctggacgcgaacgcctgcaggagttcagtggacgc
ataccgccgcgcaagaagaagaccaacagctccagcaacagcaacgcgaatccatgcagc
agcactgccaatgagagcaactgcagccaacaacgcgagacgaacaaagagaaggaacaa
cagagcttcacttggccaacagttgtcaccgtctttgtgctcgccatgggctggggcttg
tatgcagcgcgatga

DBGET integrated database retrieval system