KEGG   Drosophila hydei: 111599251
Entry
111599251         CDS       T05888                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
dhe  Drosophila hydei
Pathway
dhe04214  Apoptosis - fly
dhe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111599251
   04215 Apoptosis - multiple species
    111599251
SSDB
Motif
Pfam: DUF3177 MtrG
Other DBs
NCBI-GeneID: 111599251
NCBI-ProteinID: XP_023170619
UniProt: A0A6J1M1W5
LinkDB
Position
Unknown
AA seq 67 aa
MAVAFYIPDQKEMLRKAREQEKQLLRLRQWQMATVVLNTIRQLMDSTASQCLQRAGRKCG
KWRKPSQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggccgtggccttctacataccggaccagaaggaaatgctgcgcaaggcgcgcgagcag
gagaagcagctgttgcgtctacgtcagtggcaaatggcaacagttgtattgaacaccata
cgccagctaatggactccacggccagccagtgtctgcagcgagcaggacgcaagtgtggc
aagtggcgcaaaccatcgcagtga

DBGET integrated database retrieval system