KEGG   Drosophila hydei: 111599269
Entry
111599269         CDS       T05888                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dhe  Drosophila hydei
Pathway
dhe04214  Apoptosis - fly
dhe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111599269
   04215 Apoptosis - multiple species
    111599269
SSDB
Motif
Pfam: TFIIA Hydin_ADK Presenilin
Other DBs
NCBI-GeneID: 111599269
NCBI-ProteinID: XP_023170636
UniProt: A0A6J1M1Y1
LinkDB
Position
Unknown
AA seq 157 aa
MAIAYFIPDQAQLLARSRQQASAQQAAGSVGSSPTNVRQNEARQQQQPQQQQQQQQQQRR
QQRAGSSQFRANISVPLGREQGAMSMSEFGCWELLAQIFCYALRLYSYNPAQRRPTVIQI
SFEISSGASDADATGGAADEDAHADADVGDVTDAKQE
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcaatcgcttactttatacccgatcaggcgcaactgttggccaggagcaggcaacaa
gcaagtgcgcaacaagcagcaggcagcgtcggctcgagcccaacgaatgtcaggcaaaac
gaggcccgacaacagcaacagccacagcagcaacagcaacagcaacagcaacaacgaaga
caacaacgcgccggcagctcacagtttcgcgccaacatttcagtgccgttgggccgcgaa
cagggcgccatgtccatgtcggagttcggctgctgggagctgttggctcagattttctgc
tacgccttgcggctctacagctacaatcccgcacagcgcaggccgacagtcatacaaatc
tcgttcgagattagtagcggcgccagtgatgcggatgcaactggaggagcagcagatgag
gatgctcatgctgatgctgacgttggagacgtgacagatgcgaagcaggagtag

DBGET integrated database retrieval system