KEGG   Drosophila hydei: 111599619Help
Entry
111599619         CDS       T05888                                 

Definition
(RefSeq) aminoacylase-1-like
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
dhe  Drosophila hydei
Pathway
dhe00220  Arginine biosynthesis
dhe01100  Metabolic pathways
dhe01210  2-Oxocarboxylic acid metabolism
dhe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111599619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dhe01002]
    111599619
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dhe04147]
    111599619
Enzymes [BR:dhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     111599619
Peptidases [BR:dhe01002]
 Metallo Peptidases
  Family M20
   111599619
Exosome [BR:dhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111599619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 111599619
NCBI-ProteinID: XP_023171079
LinkDB All DBs
Position
Unknown
AA seq 390 aa AA seqDB search
MWTTLYLSLCHEINCLPSIAGCVEFIKRQAASLDLPVDVVYPVNNANPVVIVKWLGSQPD
LPSIMLNSHMDVVPVFPEHWTHGPFSADLDDEGRIFARGTQDTKGIGTQYLGAIRVLKAK
GYQPKRTIYVTFVPDEELGGFLGMQGFVKGSRFKELNVGFSLDEGCSNLSDSYFIFYAER
TTWQIRFKASGTTGHGSQLLPNTAAEKLHYVVTKLLEFRTTQVKRLKDDTTLLPGDVTAV
NLTILSGGVQNNVLPPLLEAVFDIRIAIDVDLVAFEKQIRDWCTQAGSGIEFEFERKDES
SPATKMDASNPFWTAFENSLTEQNLKYTPIVCPGCTDSRFLRPLGVSALGFSPMKNMPTL
PHAHDEFTRADIYLHGIEVYTKIIPAIASV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtggactacattatatctgagcttgtgccatgaaattaactgtctgccttcaatagcc
ggatgcgtggagtttataaagcgtcaggcagccagccttgatctgccagtggatgtcgtg
tatcctgtcaacaatgcgaatcccgtcgtcattgtgaagtggttgggtagccagccagat
ctaccttcaatcatgctcaactcgcatatggacgtggtgcctgtgttccccgaacattgg
acacacgggccgtttagcgccgatctggacgacgagggtcgaattttcgcacgtggcaca
caggacacaaagggcataggcacgcaatatctcggcgccattcgagtgctcaaggccaag
ggctaccagccgaagcgaaccatctatgtgacctttgtgcccgatgaagagctcggcggc
tttctaggcatgcaaggattcgttaagggatcccgcttcaaggaactcaacgtgggcttc
agcttggatgagggctgctccaatttaagcgactcttattttatattctatgcagagcgc
acgacgtggcagattcgattcaaggctagcggcacgacaggacatggttcccagctcctg
ccgaacactgccgccgagaagcttcattacgttgtgacgaagctgctggaattccgcacg
actcaggttaagaggcttaaagacgacacgactctcctccctggcgatgtgactgccgtg
aatctgaccatattgagcggtggcgtccaaaacaatgtgctccctcctctgctagaggca
gtgtttgacattcgcattgctatcgacgttgatctggttgccttcgagaaacagatacgt
gactggtgcacacaggcaggtagcggcatcgagttcgagtttgagcgaaaagatgaatct
tcgccagccactaagatggacgcctcgaacccattctggacagcctttgaaaactcactg
actgaacaaaacttgaagtacacgcccattgtgtgccctggatgcacggacagccgcttc
ttgaggccattgggagtgtcggcattgggcttctcaccgatgaagaacatgcccacccta
ccgcacgcacacgatgagttcacgcgcgcagacatctatctgcacggaatcgaggtttac
acgaagatcattccggccattgccagtgtctaa

DBGET integrated database retrieval system