KEGG   Drosophila hydei: 111603006Help
Entry
111603006         CDS       T05888                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dhe  Drosophila hydei
Pathway
dhe00040  Pentose and glucuronate interconversions
dhe00051  Fructose and mannose metabolism
dhe01100  Metabolic pathways
Module
dhe_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    111603006
   00051 Fructose and mannose metabolism
    111603006
Enzymes [BR:dhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     111603006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Phosphonate-bd Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 111603006
NCBI-ProteinID: XP_023176179
LinkDB All DBs
Position
Unknown
AA seq 360 aa AA seqDB search
MAQDNLTAVLHGINDLRLEQRPIPEISDEEVLVAMDSVGICGSDVHYLTKGRIGHFVVTK
PMVIGHESAGVVAKVGSKVKHLTVGDRIAIEPGVPCYKCDHCKQGSYNLCPDMAFCATPP
YDGNLTRFYKHAADFCFKLPDHVTMEEAALLEPLSVGVHACRRAGVGLGSKVLILGAGPI
GLVTLLVAQSLGATEILITDLVQQRLDVARELGATHTLLLNKDNTAEEVADRVRQLMSSE
PDKAIDCCGAESTTRLAIFATRSGGVVVIVGMGPPEMKLPLFNALAREVDIRGVFRYCND
YSAALALVASGRVNVKRLVTHHFDITETQKAFETARDGLGGAIKVMIHVQARNTNNPVSF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggataatcttacggcagtcttacatggaattaacgatttgcgattggagcaa
cgtccgataccggaaatctctgatgaggaggttttggtggccatggatagcgtaggaatt
tgtggatcagatgtgcattatttgactaaaggtcgcatcggccactttgtggtgaccaag
cccatggtaattggccacgaaagtgcaggtgtggtcgccaaagtgggtagcaaagttaag
catctgactgttggcgatcggattgccattgagccaggcgtgccttgctacaaatgcgat
cactgcaagcagggcagctacaatctgtgtcccgatatggcattctgtgccacgcctccc
tacgatggcaacctgacccgcttctataagcacgcagcggacttttgcttcaagctaccc
gatcatgtcaccatggaggaagcagctttgttagagccgttgtccgtgggtgtacatgcg
tgccgccgtgctggcgtgggcttaggttccaaggtgcttatccttggtgctggtcccatc
ggattggttacgttactggtcgctcaatctttaggcgccacggagattttgattacggat
ctagttcaacagcgtctagatgttgctagagagttgggcgctacacatacgctgcttcta
aataaagataatactgcggaagaagtcgcggatcgtgtgcgtcaattaatgagcagtgaa
cctgataaggcaattgattgctgtggagcggagagcaccacacgactggcgatcttcgcc
acacgatcgggaggtgttgttgtcatcgtaggcatgggtccgcccgaaatgaagctgcct
ctgttcaacgccttagctcgagaggtagacattcgcggtgtcttccgttactgcaatgac
tattcggccgccttggccctggtggcctctggtagagtgaatgtcaagcgccttgtcacc
caccatttcgatataactgagacacagaaagcattcgaaactgctcgggatggcttaggt
ggtgccatcaaagttatgatacacgtacaggctagaaatactaataatccagtttcattt
tag

DBGET integrated database retrieval system