KEGG   Drosophila hydei: 111603219
Entry
111603219         CDS       T05888                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
dhe  Drosophila hydei
Pathway
dhe04013  MAPK signaling pathway - fly
dhe04214  Apoptosis - fly
dhe04215  Apoptosis - multiple species
dhe04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    111603219
   04391 Hippo signaling pathway - fly
    111603219
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111603219
   04215 Apoptosis - multiple species
    111603219
SSDB
Motif
Pfam: TNFR_c6 PhoR Comm
Other DBs
NCBI-GeneID: 111603219
NCBI-ProteinID: XP_030079311
UniProt: A0A6J2SQF1
LinkDB
Position
Unknown
AA seq 405 aa
MQPLILRGTAASRAAAATGAAVAIGTAATATKLTTTSSSKCNNNLTLTIMRPATKTNSKF
HKRRRKRQRGEQCNSNSNSNINSNSSSTATATTTIRRRFSIPYLSRTGAYLTLLLLTTTC
SLCAVAAASTASASTSASGAAAAAAALTSVTNSGSVGGFVPPSSPCAPQHWWDQVQDKCM
PCTSCQDEMIPLRPCQLHIDTVCRSIYELKIDWVVLAKTEPNWKERRKSSEYEHFDQPTP
LQHLTHEQLQQLHEEAAAALPLDWQTGALFIAVLACLLFFSVAACILIHHMRQWRRMERR
LDQDVEELSTKLMAKLAEVQSLDGGTFFIGNADALRGLPASAMTAASAAASAAQSSLFQP
QHVLLPVEKHAKHQERRILKTLQPGNVYIEENQGLGAGVLANSKG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcagccgttaatactgcgtggaaccgcagctagcagagcagcagcagcaacaggcgca
gcagtggcaattggaacagcagcaacagcaacgaaattaacaacaacgagtagcagtaaa
tgtaacaacaacttaacactaactataatgcgcccagcaacaaaaacaaactccaaattt
cacaaacgtcgacgaaagcggcagcggggcgagcagtgcaacagcaacagcaacagcaac
atcaacagcaacagcagcagcacagcaacagcaacaacaacaatccgtagaagatttagc
atcccatatctaagcagaactggcgcctatctgacgcttctactgctaactacaacatgt
tccttgtgcgctgttgccgctgcatccacagcctccgcctccacctccgcctctggtgct
gccgctgctgctgccgcactcacctctgtcacgaacagcggcagcgttggcggctttgtg
ccgcccagctcgccctgtgcaccacagcattggtgggatcaggtgcaggacaagtgcatg
ccctgcaccagctgccaggacgagatgataccgctgcgaccctgccagctgcacatcgac
accgtttgccgctccatctacgagctgaagatcgactgggttgtgctggccaagacggag
cccaactggaaggagcgccgaaagtcatcggaatatgagcatttcgatcagccaacgccg
ctgcagcacttgacccacgagcagctgcaacagctgcatgaggaggcagccgctgcactg
cccctcgactggcagacgggcgccctcttcatagcggtgctcgcctgccttctattcttc
tcggtcgccgcctgcatactcatccatcatatgcgccaatggcgccgcatggagcgccga
ctggaccaagatgtggaagagttgtccacgaagctaatggccaagctggccgaggtgcag
agcctggacggtggcaccttcttcataggcaatgcagatgccttgcgcggactgcccgcc
tcggcaatgacggccgcctcggcggcagcgtccgctgcgcagtcgagcctctttcagccg
caacatgtgctgctgcctgtggaaaagcacgcaaagcatcaggagcgtaggattctgaag
accctgcagccgggcaacgtgtatatcgaggagaatcaaggactcggcgctggcgtcttg
gccaactcgaagggctga

DBGET integrated database retrieval system