KEGG   Delftia sp. HK171: BO996_02765
Entry
BO996_02765       CDS       T04584                                 

Definition
(GenBank) tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
dhk  Delftia sp. HK171
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dhk03016]
    BO996_02765
   03036 Chromosome and associated proteins [BR:dhk03036]
    BO996_02765
Transfer RNA biogenesis [BR:dhk03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BO996_02765
 Prokaryotic type
    BO996_02765
Chromosome and associated proteins [BR:dhk03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BO996_02765
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like AlaDh_PNT_C DAO Pyr_redox LmeA Thi4 Pyr_redox_3 NAD_binding_8
Other DBs
NCBI-ProteinID: APE46849
LinkDB
Position
complement(610949..612928)
AA seq 659 aa
MLYPQEFDVIVVGGGHAGTEAALAAARMGCRTLLLSHNIETLGQMSCNPSIGGIGKGHLV
KEVDALGGAMALATDIGGIQFRILNSSKGPAVRATRAQADRILYKAAIRDMLENQPNLWL
FQQAVDDLMVEGDRVVGAVTQVGVRFRSRTVVLTAGTFLDGKIHVGLNNYAAGRAGDPPA
VSLSSRLKELQLPQGRLKTGTPPRLDGRSIDFSQCEEQPGDGMPGGVNEGVLPVFSFIGN
AAMHPRQMPCWITHTNERTHDIIRSGFDRSPMFTGKIEGVGPRYCPSVEDKINRFADKES
HQIFLEPEGLTTNEFYPNGISTSLPFDIQYELVRSMKGLENAHILRPGYAIEYDYFDPRS
LKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGLNAALQCRGQEAWLPRRDEAYLGV
LVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTEAGRAMGLVDDARWDAFSRKRDA
VSRETERLKSTWVNPRIVTPEESERVLGKSIEREYNLFDLLRRPDVGYGKLMSLNEGRYA
SADVQPEVLGDLSASVVEQVEIAAKYAGYIDRQKDEVQRAAHFENLRLPAELDYMQVPAL
SFEVRQSLQKHRPETLGQASRMSGVTPAAISLLMVHLKKGGFRGFAPDVTDAKGEEASA
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgttgtacccacaggaatttgatgtgatcgtggtcggtggcggccacgccggcaccgag
gccgcgctggccgctgcgcgcatgggctgcaggacgctgctgctgagccacaacatcgag
accctgggccagatgagctgcaatcccagcatcggcgggatcggcaagggccatctggtc
aaggaagtggatgcgctgggcggcgcgatggcgctggccaccgatatcggcggcatacag
ttccgcatcctcaacagctccaagggcccggccgtgcgtgccacgcgcgcccaggccgac
cgcattctctacaaggccgccatccgcgacatgctggagaaccagcccaacctgtggctg
ttccagcaggcggtggatgacctcatggtcgagggcgaccgcgtggtgggcgccgtcacc
caggtgggcgtgcgctttcgcagccgcaccgtggtgctcacggcgggcaccttcctggac
ggcaagatccacgtgggcctgaacaactacgcggcaggccgcgcgggcgacccgccagcc
gtcagcctgtcgtcgcggctcaaggagctgcagctgccccaggggcgcctgaagaccggc
acgccgccgcgcctggatggccgcagcatcgatttctcgcagtgcgaggagcagcccggc
gacggcatgcccggtggtgtcaacgaaggcgtgctgcccgtgttcagcttcatcggcaat
gcggccatgcacccgcgccagatgccctgctggatcacccacaccaacgagcgcacgcac
gacatcatccgcagcggctttgaccgcagccccatgttcacgggcaagatcgagggcgtg
ggcccgcgctactgccccagcgtcgaggacaagatcaaccgctttgccgacaaggaaagc
caccagatcttcctggagcccgaaggcctgaccaccaacgagttctatcccaacggcatc
tccaccagcctgcccttcgacatccagtacgaactggtgcgcagcatgaaggggctggag
aacgcgcacatcctgcgccccggctacgccatcgagtacgactacttcgatccgcgctcg
ctcaagagcagcttcgagacgcgccagatccagggcctgttcttcgcgggccagatcaac
ggcacgaccggctacgaggaggcggcggcccagggcctgttcgccggcctcaacgccgcg
ctgcagtgccgcggccaggaagcctggctgccgcgccgcgacgaggcctacctgggcgtg
ctggtcgatgacctgatcaccaagggcgtgaccgagccctaccgcatgttcaccagccgc
gccgagttccggctgcagctgcgcgaggacaacgccgacatgcgcctgaccgaagcgggc
cgcgccatgggcctggtggacgatgcgcgctgggatgccttcagccgcaagcgcgatgct
gtttcacgtgaaacagagcgcctgaagtccacctgggtcaatccgcgcatcgtcacgccc
gaggaatcggagcgggtgctgggcaagtccatcgagcgcgagtacaacctgttcgacctg
ctgcgccggcccgatgtgggctacggcaagctgatgagcctgaacgagggccgctatgcc
tcggccgatgtccagcccgaggtgctgggcgatctcagcgcctccgtggtcgagcaggtg
gaaatcgcggccaagtacgcaggctacatcgaccgccagaaggacgaggtgcagcgcgcc
gcccacttcgagaacctgcgcctgccggccgagctggactatatgcaggtgccggccctg
tccttcgaggtgcgccagtcgctgcaaaagcacaggcccgaaaccttgggccaggcgtcg
cgcatgtcgggcgtgacgccggcggcgatctcgctgctgatggtgcatctgaagaagggc
ggctttcggggctttgcaccggatgtgactgacgcgaagggcgaggaggcatccgcatga

DBGET integrated database retrieval system